Property Summary

NCBI Gene PubMed Count 287
PubMed Score 1493.96
PubTator Score 626.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Ewing sarcoma 25 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 4.408 2.2
Neurodegenerative disease 414 0.0 4.0

Expression

Protein-protein Interaction (1)

Gene RIF (256)

AA Sequence

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS      1 - 70
TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ     71 - 140
QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ    141 - 210
QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD    211 - 280
NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA    281 - 350
IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ    351 - 420
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD    421 - 490
RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY                                      491 - 526
//

Text Mined References (303)

PMID Year Title