Property Summary

NCBI Gene PubMed Count 263
PubMed Score 1454.18
PubTator Score 626.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
osteosarcoma 7933 2.68606098514626E-8
posterior fossa group B ependymoma 1530 4.55423702129523E-6
psoriasis 6685 4.9407982666575E-5
Multiple myeloma 1328 1.34481122642769E-4
adrenocortical carcinoma 1427 2.67116225493966E-4
ovarian cancer 8492 9.90691855572139E-4
oligodendroglioma 2849 0.00298674296756281
astrocytic glioma 2241 0.00310874962479006
Waldenstrons macroglobulinemia 765 0.00512420602874647
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00647057264732086
group 3 medulloblastoma 2254 0.00831784867164982
subependymal giant cell astrocytoma 2287 0.00996317742192415
gastric carcinoma 832 0.0119803264766776
hepatocellular carcinoma 550 0.0125338474305694
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0129626787790702
non primary Sjogren syndrome sicca 840 0.0149300061511733
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0194026555578202
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0263301346136866
medulloblastoma, large-cell 6234 0.0281850128475998
Disease Target Count Z-score Confidence
Ewing sarcoma 27 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 4.42 2.2
Neurodegenerative disease 383 0.0 4.0

Expression

Synonym

Accession P35637 Q9H4A8
Symbols TLS
ALS6
ETM4
FUS1
POMP75
HNRNPP2

Gene

FUS

PDB

2LA6   2LCW   4FDD   4FQ3  

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (232)

PMID Text
26984092 A subset of juvenile-onset familial/sporadic ALS cases with FUS gene mutations reportedly demonstrates mental retardation or learning difficulty.
26865464 FUS-DDIT3 is uniquely regulated at the transcriptional as well as the post-translational level and that its expression level is important for myxoid liposarcoma tumour development.
26842965 FUS-dependent motor degeneration is not due to loss of FUS function, but to the gain of toxic properties conferred by ALS mutations.
26795035 iNeurons may provide a more reliable model for investigating FUS mutations with disrupted NLS for understanding FUS-associated proteinopathies in amyotrophic lateral sclerosis
26690869 prevalence of the FUS-ERG gene fusion in a large cohort of pathologically and molecularly well characterized small blue round cell tumors, lacking other known gene rearrangements
26611653 Genetic polymorphisms in the TLS genes might serve as potential predictive biomarkers of prognosis of advanced NSCLC patients treated with platinum-based chemotherapy.
26605911 Study identifies a common mechanism of transport into neurites of proteins linked to the pathology of Alzheimer's disease (i.e. sAPP) and ALS (i.e. FUS, TDP-43 and SOD1)
26573619 FUS and EWS target genes involved in pathways at the RNA regulatory level
26514432 TDP-43 and FUS were found to regulate splicing and expression of genes related to neuronal (SEPT6, SULT4A1, TNIK) and RNA metabolism (DICER, ELAVL3/HuC, POLDIP3).
26455390 FUS low-complexicity phase separates to recruit RNA polymerase II C-terminal domain in vitro.
More...

AA Sequence

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS      1 - 70
TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ     71 - 140
QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ    141 - 210
QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD    211 - 280
NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA    281 - 350
IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ    351 - 420
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD    421 - 490
RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY                                      491 - 526
//

Text Mined References (276)

PMID Year Title
26984092 2016 Juvenile-onset Sporadic Amyotrophic Lateral Sclerosis with a Frameshift FUS Gene Mutation Presenting Unique Neuroradiological Findings and Cognitive Impairment.
26865464 2016 Regulatory mechanisms, expression levels and proliferation effects of the FUS-DDIT3 fusion oncogene in liposarcoma.
26842965 2016 ALS-associated mutant FUS induces selective motor neuron degeneration through toxic gain of function.
26795035 2016 Directly converted patient-specific induced neurons mirror the neuropathology of FUS with disrupted nuclear localization in amyotrophic lateral sclerosis.
26690869 2016 Ewing sarcoma with ERG gene rearrangements: A molecular study focusing on the prevalence of FUS-ERG and common pitfalls in detecting EWSR1-ERG fusions by FISH.
26611653 2016 Association of polymorphisms in translesion synthesis genes with prognosis of advanced non-small-cell lung cancer patients treated with platinum-based chemotherapy.
26605911 2016 Shared Molecular Mechanisms in Alzheimer's Disease and Amyotrophic Lateral Sclerosis: Neurofilament-Dependent Transport of sAPP, FUS, TDP-43 and SOD1, with Endoplasmic Reticulum-Like Tubules.
26573619 2015 EWS and FUS bind a subset of transcribed genes encoding proteins enriched in RNA regulatory functions.
26514432 2015 From transcriptomic to protein level changes in TDP-43 and FUS loss-of-function cell models.
26455390 2015 Residue-by-Residue View of In Vitro FUS Granules that Bind the C-Terminal Domain of RNA Polymerase II.
More...