Property Summary

NCBI Gene PubMed Count 42
Grant Count 64
R01 Count 39
Funding $9,934,549.07
PubMed Score 36.43
PubTator Score 57.90

Knowledge Summary

Patent (4,304)

Expression

  Differential Expression (26)

Synonym

Accession P35626 Q9UGW9 Beta-ARK-2
Symbols BARK2
ADRBK2

Gene

Gene RIF (26)

PMID Text
27049755 effects of GRK3 modulation appear to be specific to chemokine-mediated migration behaviors without influencing tumor cell proliferation or survival
24434559 data are consistent with the possibility that oncogenes can induce cellular stiffness via an HDAC6-induced reorganization of the vimentin intermediate filament network
23734232 Data indicate that CXCL12-induced phosphorylation at CXCR4 S346/347 was mediated by GRK2/3.
22086906 GRK3 is a negative regulator of cell growth whose expression is preferentially reduced in glioblastoma of the classical subtype as a consequence of activity in primary gliomagenic pathways.
21916780 In oral squamous cell carcinomas, malignant cells and surrounding tissue overexpress the ADRBK2 gene.
21784156 A reduced cortical concentration of GRK3 in schizophrenia (resembling that in aging) may result in altered G protein-dependent signaling, thus contributing to prefrontal deficits in schizophrenia.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKD      1 - 70
FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQ     71 - 140
VTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRK    141 - 210
ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLH    211 - 280
YHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHAS    281 - 350
VGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE    351 - 420
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDE    421 - 490
EDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI    491 - 560
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQF    561 - 630
VLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL                631 - 688
//

Text Mined References (44)

PMID Year Title
27049755 2016 G Protein Coupled Receptor Kinase 3 Regulates Breast Cancer Migration, Invasion, and Metastasis.
24434559 2014 GRK3 is essential for metastatic cells and promotes prostate tumor progression.
23734232 2013 Hierarchical organization of multi-site phosphorylation at the CXCR4 C terminus.
22086906 2012 Suppression of G-protein-coupled receptor kinase 3 expression is a feature of classical GBM that is required for maximal growth.
21916780 2012 Activity of ?2-adrenergic receptor in oral squamous cell carcinoma is mediated by overexpression of the ADRBK2 gene: a pilot study.
21784156 2011 Reduced expression of G protein-coupled receptor kinases in schizophrenia but not in schizoaffective disorder.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
More...