Property Summary

Ligand Count 5
NCBI Gene PubMed Count 41
PubMed Score 40.83
PubTator Score 57.90

Knowledge Summary

Patent (4,304)

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.433 6.3e-03
active ulcerative colitis 1.757 8.4e-03
adrenocortical carcinoma -1.246 1.1e-02
adult high grade glioma -3.000 1.2e-06
astrocytoma -1.200 3.8e-11
Astrocytoma, Pilocytic -2.300 5.7e-09
atypical teratoid / rhabdoid tumor -3.100 8.8e-07
Breast cancer -1.600 6.5e-08
breast carcinoma -1.300 7.1e-23
cystic fibrosis -1.200 3.0e-05
ductal carcinoma in situ -1.500 7.8e-04
ependymoma -2.500 3.7e-11
glioblastoma -2.600 3.5e-09
interstitial lung disease 1.200 1.9e-02
intraductal papillary-mucinous adenoma (... -1.100 1.2e-03
intraductal papillary-mucinous carcinoma... -1.500 3.2e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.4e-02
invasive ductal carcinoma -1.500 6.8e-03
lung cancer -1.500 3.9e-03
malignant mesothelioma -1.200 8.6e-06
medulloblastoma, large-cell -2.800 6.4e-06
oligodendroglioma -1.300 3.6e-08
osteosarcoma -1.214 3.3e-03
ovarian cancer -2.000 1.3e-05
primary Sjogren syndrome 1.500 8.4e-05
tuberculosis 1.300 1.4e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKD      1 - 70
FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQ     71 - 140
VTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRK    141 - 210
ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLH    211 - 280
YHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHAS    281 - 350
VGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE    351 - 420
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDE    421 - 490
EDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI    491 - 560
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQF    561 - 630
VLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL                631 - 688
//

Text Mined References (43)

PMID Year Title