Property Summary

NCBI Gene PubMed Count 255
PubMed Score 592.30
PubTator Score 462.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
Sorsby Fundus Dystrophy 1

Expression

  Differential Expression (33)

Disease log2 FC p
adrenocortical carcinoma -1.321 2.5e-02
astrocytic glioma 1.800 7.2e-03
Astrocytoma, Pilocytic 2.200 2.7e-11
Atopic dermatitis -1.100 8.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.012 3.9e-02
breast carcinoma -1.100 1.4e-03
cystic fibrosis -1.100 1.5e-04
Down syndrome 1.100 1.6e-03
ductal carcinoma in situ -1.400 6.5e-04
fibroadenoma -1.300 1.7e-02
gastric carcinoma 1.400 2.9e-02
glioblastoma 1.300 5.2e-04
group 4 medulloblastoma -1.100 3.3e-04
intraductal papillary-mucinous adenoma (... -1.100 2.5e-02
intraductal papillary-mucinous carcinoma... -2.100 2.0e-04
intraductal papillary-mucinous neoplasm ... -1.600 2.8e-02
invasive ductal carcinoma -1.200 2.0e-02
limb girdle muscular dystrophy 2I 1.043 5.2e-03
lung adenocarcinoma -1.300 1.1e-09
lung cancer -3.300 6.9e-06
lung carcinoma -1.200 1.6e-12
malignant mesothelioma 2.200 5.2e-05
non primary Sjogren syndrome sicca 1.200 5.6e-03
non-small cell lung cancer -1.234 2.5e-10
oligodendroglioma 2.000 6.4e-03
osteosarcoma 2.614 2.0e-03
ovarian cancer -1.600 2.8e-07
pancreatic cancer 2.800 8.8e-05
pancreatic ductal adenocarcinoma liver m... -1.250 1.8e-02
pediatric high grade glioma 1.300 3.8e-04
primitive neuroectodermal tumor 1.300 1.0e-02
psoriasis -1.600 6.0e-05
ulcerative colitis 1.500 1.6e-03

 GWAS Trait (1)

Gene RIF (216)

AA Sequence

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMY      1 - 70
RGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYH     71 - 140
LGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATD    141 - 210
P//

Text Mined References (256)

PMID Year Title