Property Summary

NCBI Gene PubMed Count 229
Grant Count 184
R01 Count 115
Funding $18,807,852.53
PubMed Score 554.56
PubTator Score 462.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Expression

Synonym

Accession P35625 B2RBY9 Q5THV4 Q9UC74 Q9UGS2
Symbols SFD
K222
K222TA2
HSMRK222

Gene

PDB

3CKI  

Gene RIF (192)

PMID Text
26872030 TIMP3 was validated as a direct target of miRNA-21 by dual-luciferase reporter assay. Silencing with small interfering RNA against TIMP3 promoted angiogenesis and increased MMP2 and MMP9 expression at the protein level.
26707830 TIMP3 is a dominant negative regulator of angiogenesis in cutaneous melanoma and gene silencing by promoter methylation is associated with poor outcome
26686417 Taken together, our results suggest that the imbalance between aggrecanase and TIMP-3 may play an important role in the pathogenesis of IDD and therefore be a potential therapeutic target for treating IDD.
26676407 expression of TIMP3 is low in pituitary adenomas including ACTH-secreting pituitary adenomas and negatively associated with tumor aggressiveness.
26579821 Results suggest that gene-environment interactions between the TIMP3 rs9862 polymorphisms and betel quid may alter oral cancer susceptibility and tumor growth in Taiwanese men.
26304100 Genotypes of rs135025 and rs80272 in TIMP3 contribute to the development of preeclampsia in Han Chinese women.
26123869 following acute ACL injury, an upregulation of TIMP-3, the primary aggrecanase inhibitor, is elicited in response to increased aggrecan degradation, which may inhibit further cleavage
26068512 Gene-gene interactions between Smad3 rs6494629T/C and TIMP3 rs715572G/A polymorphisms may play more important protective roles in knee OA.
25819812 The miR-191-TIMP3 axis might be critical in the malignant transformation of endometriosis to endometriosis-associated ovarian cancer.
25766588 This study expands the spectrum of mutations in the TIMP3 gene and associated phenotypic findings. Imaging using late-phase ICG-A may be useful for early identification of individuals at risk for developing SFD.
More...

AA Sequence

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMY      1 - 70
RGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYH     71 - 140
LGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATD    141 - 210
P//

Text Mined References (230)

PMID Year Title
26872030 2016 The Angiogenic Effect of microRNA-21 Targeting TIMP3 through the Regulation of MMP2 and MMP9.
26707830 2016 Association of TIMP3 expression with vessel density, macrophage infiltration and prognosis in human malignant melanoma.
26686417 2016 The imbalance between TIMP3 and matrix-degrading enzymes plays an important role in intervertebral disc degeneration.
26676407 2016 The Clinical Utility of TIMP3 Expression in ACTH-Secreting Pituitary Tumor.
26579821 2015 Polymorphisms and Plasma Levels of Tissue Inhibitor of Metalloproteinase-3: Impact on Genetic Susceptibility and Clinical Outcome of Oral Cancer.
26304100 2015 Contribution of TIMP3 polymorphisms to the development of preeclampsia in Han Chinese women.
26123869 2015 Relationship between synovial fluid ARGS-aggrecan fragments, cytokines, MMPs, and TIMPs following acute ACL injury: A cross-sectional study.
26068512 2015 Gene-gene interactions between TGF-?/Smad3 signalling pathway polymorphisms affect susceptibility to knee osteoarthritis.
25819812 2015 MiR-191 modulates malignant transformation of endometriosis through regulating TIMP3.
25766588 2015 Sorsby Fundus Dystrophy: Novel Mutations, Novel Phenotypic Characteristics, and Treatment Outcomes.
More...