Property Summary

NCBI Gene PubMed Count 197
PubMed Score 275.85
PubTator Score 227.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 7.26250403184814E-9
ovarian cancer 8492 2.61792399329418E-7
medulloblastoma, large-cell 6234 0.00107129339633674
Rheumatoid Arthritis 1171 0.00122483708910084
primary pancreatic ductal adenocarcinoma 1271 0.00202088742430122
oligodendroglioma 2849 0.00212750911654664
gastric carcinoma 832 0.00905328809924139
astrocytic glioma 2241 0.01377733095211
subependymal giant cell astrocytoma 2287 0.0326974978335259
ependymoma 2514 0.0371522055753977
Disease Target Count
Hypertension 293
Essential Hypertension 82

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.001
astrocytic glioma 1.200 0.014
ependymoma 1.100 0.037
oligodendroglioma 1.500 0.002
osteosarcoma 2.306 0.000
medulloblastoma, large-cell -1.300 0.001
primary pancreatic ductal adenocarcinoma 1.007 0.002
subependymal giant cell astrocytoma -1.282 0.033
gastric carcinoma 1.100 0.009
ovarian cancer -1.800 0.000

Gene RIF (212)

PMID Text
27349000 study shows that the a-adducin G460T polymorphism is associated with essential hypertension
27340988 This indicates that ADD1 G460W polymorphism could be an important factor in the pathophysiology of tinnitus.
26042478 The T allele of ADD1 is associated with essential hypertension in Asians.
25816007 Study shows that ADD1-rs4963 conferred susceptibility to colorectal cancer (CRC) suggesting an association between ADD1 and CRC risk.
25567773 study of potential effects of interaction between DNA methylation of ADD1 promoter and ADD1 tagSNPs and environmental factors on essential hypertension (EH); results indicate ADD1 SNP rs4961 has a protective role in development of EH; interactions between alcohol consumption and DNA methylation of ADD1 gene promoter have a significant role in modifying EH susceptibility
25344630 When alpha-adducin complexes with sodium potassium ATPase in astrocytes, non-cell autonomous neurodegeneration is triggered.
25262176 There were significant differences between the control group and pediatric hypertensive group in terms of ACE I/D (P<0.05) and AGT M235T (P<0.05) polymorphisms, but there were no differences in ADD Gly460Trp (P>0.05) polymorphism.
24718403 A significant association was found between ADD1 gene G614T polymorphism and essential hypertension in Chinese patients. Further studies need to be done to confirm these findings in a large sample.
24711455 Data indicate that adducin promotes adhesion by regulating desmosomes and is part of a protective pathway in pemphigus.
24379415 Phosphorylation of ADD1 at Ser12 and Ser355 by cyclin-dependent kinase 1 enables ADD1 to bind to myosin-X (Myo10).
More...

AA Sequence

MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEE      1 - 70
LESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDK     71 - 140
GEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRG    141 - 210
STNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDE    211 - 280
EEKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK    281 - 350
AKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS    351 - 420
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFV    421 - 490
PLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTG    491 - 560
PNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGD    561 - 630
DSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEG    631 - 700
AAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS                                     701 - 737
//

Text Mined References (209)

PMID Year Title
27349000 2016 Alpha Adducin G460T Variant is a Risk Factor for Hypertension in Tunisian Population.
27340988 2016 Angiotensin-Converting Enzyme (ACE) I/D and Alpha-Adducin (ADD1) G460W Gene Polymorphisms in Turkish Patients with Severe Chronic Tinnitus.
26042478 2015 Association of alpha-ADD1 Gene and Hypertension Risk: A Meta-Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25816007 2015 A phosphorylation-related variant ADD1-rs4963 modifies the risk of colorectal cancer.
25567773 2015 The interactions between alcohol consumption and DNA methylation of the ADD1 gene promoter modulate essential hypertension susceptibility in a population-based, case-control study.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25344630 2014 An ?2-Na/K ATPase/?-adducin complex in astrocytes triggers non-cell autonomous neurodegeneration.
25262176 2014 Gene polymorphisms of adducin GLY460TRP, ACE I/D, AND AGT M235T in pediatric hypertension patients.
More...