Property Summary

NCBI Gene PubMed Count 201
PubMed Score 291.87
PubTator Score 227.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 1.4e-02
ependymoma 1.100 3.7e-02
gastric carcinoma 1.100 9.1e-03
medulloblastoma, large-cell -1.300 1.1e-03
oligodendroglioma 1.500 2.1e-03
osteosarcoma -1.538 9.1e-04
ovarian cancer -1.800 2.6e-07
primary pancreatic ductal adenocarcinoma 1.007 2.0e-03
Rheumatoid arthritis 1.200 1.2e-03
subependymal giant cell astrocytoma -1.282 3.3e-02

Gene RIF (215)

AA Sequence

MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEE      1 - 70
LESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDK     71 - 140
GEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRG    141 - 210
STNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDE    211 - 280
EEKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK    281 - 350
AKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS    351 - 420
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFV    421 - 490
PLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTG    491 - 560
PNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGD    561 - 630
DSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEG    631 - 700
AAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS                                     701 - 737
//

Text Mined References (213)

PMID Year Title