Property Summary

Ligand Count 125
NCBI Gene PubMed Count 52
PubMed Score 138.25
PubTator Score 227.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.001 3.2e-02
adrenocortical carcinoma -1.406 9.9e-05
adult high grade glioma 2.000 1.2e-04
astrocytoma 1.100 2.6e-10
Astrocytoma, Pilocytic 1.900 4.3e-08
Atopic dermatitis -1.900 3.5e-02
atypical teratoid / rhabdoid tumor 1.200 2.5e-03
breast carcinoma 1.100 2.8e-12
ependymoma 1.400 1.6e-06
glioblastoma 2.300 7.0e-11
intraductal papillary-mucinous carcinoma... -1.200 4.6e-02
intraductal papillary-mucinous neoplasm ... -1.600 1.2e-02
invasive ductal carcinoma 1.100 1.1e-02
lung adenocarcinoma 1.046 9.9e-04
osteosarcoma 1.297 2.2e-02
ovarian cancer -1.500 1.6e-06
primitive neuroectodermal tumor 1.300 1.3e-04
psoriasis -2.900 1.0e-04
subependymal giant cell astrocytoma 1.887 4.7e-03

Protein-protein Interaction (1)

Gene RIF (37)

AA Sequence

MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVG      1 - 70
SHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT     71 - 140
IYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGY    141 - 210
SKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLN    211 - 280
SAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFR    281 - 350
NIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW    351 - 420
NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIV    421 - 490
NDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF              491 - 550
//

Text Mined References (57)

PMID Year Title