Property Summary

NCBI Gene PubMed Count 97
PubMed Score 72.87
PubTator Score 23.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy -1.337 1.4e-06
astrocytoma -1.100 3.9e-02
Astrocytoma, Pilocytic -1.200 2.5e-04
atypical teratoid / rhabdoid tumor -1.900 3.3e-05
ependymoma -1.500 5.6e-10
glioblastoma -1.200 9.8e-03
group 3 medulloblastoma -1.700 8.8e-03
lung adenocarcinoma -1.400 2.3e-12
lung cancer -1.600 3.3e-03
medulloblastoma, large-cell -1.600 6.4e-03
non-small cell lung carcinoma -1.100 1.8e-31
osteosarcoma 2.242 7.7e-03
ovarian cancer 1.400 1.6e-12
pediatric high grade glioma -1.200 1.3e-02
Pick disease -1.500 2.8e-03
primitive neuroectodermal tumor -2.300 1.1e-03
psoriasis -1.200 8.7e-11

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGL      1 - 70
KLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILR     71 - 140
FAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIG    141 - 210
NINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENE    211 - 280
RLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQT    281 - 350
KLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK    351 - 420
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQW    421 - 490
DRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQ    491 - 560
FKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELA    561 - 630
RQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQ    631 - 700
LIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKN    701 - 770
GLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS    771 - 840
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL                    841 - 894
//

Text Mined References (105)

PMID Year Title