Property Summary

NCBI Gene PubMed Count 33
PubMed Score 24.18
PubTator Score 65.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.400 8.0e-03
hepatocellular carcinoma 1.200 2.0e-05
non-small cell lung cancer 1.043 9.1e-25
ovarian cancer 2.500 2.9e-05
pancreatic cancer 1.300 2.6e-03
pancreatic carcinoma 1.300 2.6e-03
primary pancreatic ductal adenocarcinoma -1.004 7.3e-03
tuberculosis and treatment for 3 months -1.400 6.1e-04
Waldenstrons macroglobulinemia 1.055 4.5e-03

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKN      1 - 70
WVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEG     71 - 140
HTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRL    141 - 210
VKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASL    211 - 280
RGSNNVALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGS    281 - 350
CEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAIRESNSIVKIFKNFKE    351 - 420
KKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIATEESFFILKY    421 - 490
LSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRT    491 - 560
MYLLGYIPKDNRLYLGDKELNIISYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGF    561 - 630
KQQALTVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLL    631 - 700
LLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVV    701 - 770
KLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGK    771 - 840
DFQPSRSTAQQELDGKPASPTPVIVASHTANKEEKSLLELEVDLDNLELEDIDTTDINLDEDILDD        841 - 906
//

Text Mined References (46)

PMID Year Title