Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.82
PubTator Score 65.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 9.13444076896528E-25
tuberculosis and treatment for 6 months 686 9.38981972106081E-6
hepatocellular carcinoma 550 1.98225576491516E-5
ovarian cancer 8492 2.9337019493895E-5
pancreatic cancer 2300 0.00255994707837268
pancreatic carcinoma 567 0.00255994707837268
Waldenstrons macroglobulinemia 765 0.00445565094958319
primary pancreatic ductal adenocarcinoma 1271 0.00725612315938646
glioblastoma 5572 0.00800459641881818
Disease Target Count Z-score Confidence
Blepharophimosis 17 4.29 2.1
Ptosis 42 3.309 1.7
Scrub typhus 7 3.184 1.6

Expression

  Differential Expression (9)

Synonym

Accession P35606 B4DZI8
Symbols beta'-COP

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (3)

PMID Text
26423947 HIV-1 Nef weakly and directly interacts with COPB2 (beta-COP) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
20362547 these data suggest that beta-COP plays a critical role in the forward transport of TREK1 channel to the plasma membrane.
18434597 Golgi organization depends on mutually interacting domains in betaCOP and p115, suggesting that vesicle tethering at the Golgi involves p115 binding to the COPI coat

AA Sequence

MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKN      1 - 70
WVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEG     71 - 140
HTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRL    141 - 210
VKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASL    211 - 280
RGSNNVALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGS    281 - 350
CEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAIRESNSIVKIFKNFKE    351 - 420
KKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIATEESFFILKY    421 - 490
LSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRT    491 - 560
MYLLGYIPKDNRLYLGDKELNIISYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGF    561 - 630
KQQALTVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLL    631 - 700
LLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVV    701 - 770
KLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGK    771 - 840
DFQPSRSTAQQELDGKPASPTPVIVASHTANKEEKSLLELEVDLDNLELEDIDTTDINLDEDILDD        841 - 906
//

Text Mined References (43)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22446961 2012 Two new susceptibility loci for Kawasaki disease identified through genome-wide association analysis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20362547 2010 Enhancement of TREK1 channel surface expression by protein-protein interaction with beta-COP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...