Property Summary

NCBI Gene PubMed Count 39
Grant Count 160
R01 Count 70
Funding $15,436,637.64
PubMed Score 250.99
PubTator Score 82.55

Knowledge Summary

Patent (46,581)

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.157 0.002
malignant mesothelioma 3.800 0.000
psoriasis -1.300 0.000
osteosarcoma -1.756 0.029
cystic fibrosis 1.179 0.001
juvenile dermatomyositis 1.163 0.000
non-small cell lung cancer -2.339 0.000
lung cancer -1.900 0.000
interstitial cystitis 1.700 0.000
lung adenocarcinoma -2.100 0.000
aldosterone-producing adenoma -1.086 0.012
lung carcinoma -1.600 0.000
gastric carcinoma 1.500 0.014
ductal carcinoma in situ -1.200 0.006
invasive ductal carcinoma -1.800 0.003
pituitary cancer -1.300 0.001

Synonym

Accession P35590 B5A949 B5A950
Symbols TIE
JTK14

Gene

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26489611 The inhibition of Tie-2 exerted by Tie-1can be relieved by Tie-1 ectodomain cleavage mediated by tumor- and inflammatory-related factors, which causes destabilization of vessels and initiates vessel remodeling in cancer. (Review)
26436659 T794A-expressing human umbilical vein endothelial cells formed significantly shorter tubes with fewer branches in three-dimensional Matrigel cultures, but did not alter Tie1 or Tie2 tyrosine phosphorylation or downstream signaling.
22987233 The decreasing expression of Tie1 may play an important role in the pathogenesis of primary lower extremity varicose veins.
22421998 Data propose that EndMT associated with Tie1 downregulation participates in the pathological development of stroma observed in tumours.
22342979 these results suggest that the expression level of Tie1 and its physical interaction with Tie2 defines whether Ang2 functions as a Tie2 agonist or antagonist, thereby determining the context-dependent differential endothelial sensitivity to Ang2.
22235284 the effects of factors activating ectodomain cleavage on both Tie1 and Tie2 within the same population of cells, and their impact on angiopoietin signalling
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20227369 Provide evidence for Tie1-Tie2 complex formation on the cell surface and identify molecular surface areas essential for recognition. The Tie1-Tie2 interactions are dynamic, inhibitory, and differentially modulated by angiopoietin-1 and -2.
20164029 The Tie-1 immunoreactivity was dominantly observed in the heamangiogenic cells and cells cords, whereas the matured villi showed immunoreactivity only in other components.
More...

AA Sequence

MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIV      1 - 70
RTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGD     71 - 140
TAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRL    141 - 210
IVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRG    211 - 280
LTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRI    281 - 350
PQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD    351 - 420
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDST    421 - 490
MDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTD    491 - 560
RLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGP    561 - 630
ASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEE    631 - 700
TSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVS    701 - 770
ATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT    771 - 840
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNR    841 - 910
GYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDL    911 - 980
AARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLG    981 - 1050
GTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNM   1051 - 1120
SLFENFTYAGIDATAEEA                                                       1121 - 1138
//

Text Mined References (42)

PMID Year Title
26489611 2015 Tie-1: A potential target for anti-angiogenesis therapy.
26436659 2015 Phosphorylation of Threonine 794 on Tie1 by Rac1/PAK1 Reveals a Novel Angiogenesis Regulatory Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
22987233 2013 Abnormal expression of Tie1 on the valves of great saphenous varicose vein.
22421998 2012 Tie1 deficiency induces endothelial-mesenchymal transition.
22342979 2012 Tie1 regulates the Tie2 agonistic role of angiopoietin-2 in human lymphatic endothelial cells.
22235284 2012 The molecular balance between receptor tyrosine kinases Tie1 and Tie2 is dynamically controlled by VEGF and TNF? and regulates angiopoietin signalling.
22103492 2011 Molecular control of angiopoietin signalling.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...