Property Summary

NCBI Gene PubMed Count 63
Grant Count 22
R01 Count 10
Funding $1,608,577.91
PubMed Score 52.10
PubTator Score 31.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26368311 Data show that myosin II supports a stable Rho zone at the at E-cadherin junctions.
26136073 myosin IIA and IIB heavy chains play distinct and non-redundant roles in matrix remodeling
25881509 Our results indicate that MYH10 contributes to ciliogenesis in RPE1 cells by promoting cortical actin-dependent centriole migration.
25869664 The role of nonmuscle myosin II (NMII)-B in front-back migratory cell polarity is controlled by a short stretch of amino acids containing five serines.
25631816 A receptor type-protein tyrosine phosphatase alpha-Src family kinase-Rap1 pathway was identified as responsible for recruiting myosin IIB to the zonula adherens in epithelial cells and supporting contractile tension.
25567808 Myosin isoforms impact single-fiber force generation and may lead to alterations in whole skeletal muscle performance.
25010285 Interaction of HIV-1 Gag with myosin, heavy chain 10, non-muscle (MYH10) is identified in a series of six affinity purification/mass spectrometry screens
24858044 The findings suggest that elevated NMHCIIb levels contribute to meningioma tumor formation and progression.
24088567 Supervillin concentrates activated and total myosin II at the furrow, and simultaneous knockdown of supervillin and anillin additively increases cell division failure.
24072716 The data show that although NM IIA and IIB form filaments with similar properties, NM IIC forms filaments that are less well suited to roles such as tension maintenance within the cell.
More...

AA Sequence

MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAM      1 - 70
VNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIE     71 - 140
MYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNI    141 - 210
PGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERT    211 - 280
FHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV    281 - 350
SSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA    351 - 420
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHT    421 - 490
MFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSH    491 - 560
SKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQ    561 - 630
VTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLR    631 - 700
CNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFF    701 - 770
RAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK    771 - 840
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMR    841 - 910
ARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKI    911 - 980
KKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTR    981 - 1050
QELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQI   1051 - 1120
AELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNH   1121 - 1190
EAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ   1191 - 1260
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQ   1261 - 1330
KLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKD   1331 - 1400
AEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEE   1401 - 1470
RDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQ   1471 - 1540
VEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERK   1541 - 1610
QRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK   1611 - 1680
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQS   1681 - 1750
NMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALE   1751 - 1820
AKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAE   1821 - 1890
EEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDT   1891 - 1960
ESKTSDVNETQPPQSE                                                         1961 - 1976
//

Text Mined References (82)

PMID Year Title
26368311 2015 Feedback regulation through myosin II confers robustness on RhoA signalling at E-cadherin junctions.
26136073 2015 Non-Muscle Myosin II Isoforms Have Different Functions in Matrix Rearrangement by MDA-MB-231 Cells.
25881509 2015 Myosin heavy chain 10 (MYH10) is required for centriole migration during the biogenesis of primary cilia.
25869664 2015 A regulatory motif in nonmuscle myosin II-B regulates its role in migratory front-back polarity.
25631816 2015 An RPTP?/Src family kinase/Rap1 signaling module recruits myosin IIB to support contractile tension at apical E-cadherin junctions.
25567808 2015 Molecular determinants of force production in human skeletal muscle fibers: effects of myosin isoform expression and cross-sectional area.
24858044 2015 miR-200a-mediated suppression of non-muscle heavy chain IIb inhibits meningioma cell migration and tumor growth in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24088567 2013 Supervillin binding to myosin II and synergism with anillin are required for cytokinesis.
24072716 2013 Characterization of three full-length human nonmuscle myosin II paralogs.
More...