Property Summary

NCBI Gene PubMed Count 261
Grant Count 196
R01 Count 30
Funding $50,162,276.51
PubMed Score 996.75
PubTator Score 410.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma -1.282 0.012
non diabetic and post-ischemic heart fai... -1.400 0.008
diabetes mellitus -1.400 0.004
acute myeloid leukemia 1.800 0.014
ovarian cancer 2.200 0.000

Synonym

Accession P35579 A8K6E4 O60805 Q60FE2 Q86T83
Symbols MHA
FTNS
EPSTS
BDPLT6
DFNA17
NMMHCA
NMHC-II-A
NMMHC-IIA

Gene

PDB

2LNK   3ZWH   4CFQ   4CFR   4ETO  

Gene RIF (199)

PMID Text
26861218 7 members in 3 generations of a family had macrothrombocytopenia without Alport syndrome, and they all had a p.A95V mutation in exon 1 of MYH9. This affects the motor domain.
26719067 the present study indicated that knockdown of NMIIA inhibited the migration and invasion of gastric cancer cells, which may be, at least in part, mediated via the JNK signaling pathway.
26499037 Knocking down myosin-9 or promoting protein S-glutathionylation by knocking down glutaredoxin-1 inhibited the death of airway smooth muscle cells by heating to simulate bronchial thermoplasty
26368311 Data show that myosin II supports a stable Rho zone at the at E-cadherin junctions.
26226608 Severity and progression of sensorineural hearing loss appeared to depend on the specific NMMHC-IIA mutation in patients with MYH9-related disease.
26152646 heterozygotic form (allele A) of the MYH9 gene could be considered a very early marker, a new risk factor for the appearance of CKD, or a sign of renal frailty in elderly people.
26147622 concordant with the genetic interaction observed in sickle cell disease patients, APOL1 G2 reduces myh9 expression in vivo, suggesting a possible interaction between the altered APOL1 and myh9.
26136073 myosin IIA and IIB heavy chains play distinct and non-redundant roles in matrix remodeling
26056797 MYH9 p.R1165C mutation is associated with MYH9 Disorder.
26051904 A novel MYH9 mutation in a patient with MYH9 disorders and platelet size-specific effect of romiplostim on macrothrombocytopenia.
More...

AA Sequence

MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKD      1 - 70
DIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKG     71 - 140
KKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQ    141 - 210
LLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYL    211 - 280
LSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLG    281 - 350
NIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA    351 - 420
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQE    421 - 490
EYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPK    491 - 560
QLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSET    561 - 630
ALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEG    631 - 700
IRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAH    701 - 770
LEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV    771 - 840
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKK    841 - 910
QELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQ    911 - 980
IILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTR    981 - 1050
RKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDL   1051 - 1120
ESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEM   1121 - 1190
RQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK   1191 - 1260
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTK   1261 - 1330
LKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQR   1331 - 1400
HEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAE   1401 - 1470
AREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQ   1471 - 1540
LEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVA   1541 - 1610
ARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA   1611 - 1680
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELIND   1681 - 1750
RLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLE   1751 - 1820
EQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRAN   1821 - 1890
ASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE   1891 - 1960
//

Text Mined References (282)

PMID Year Title
26861218 2016 A Japanese pedigree with a p.A95V mutation in the MYH9 gene demonstrates inherited macrothrombocytopenia without Alport manifestations.
26719067 2016 Downregulation of non?muscle myosin IIA expression inhibits migration and invasion of gastric cancer cells via the c?Jun N?terminal kinase signaling pathway.
26499037 2016 Major vault protein regulates cell growth/survival signaling through oxidative modifications.
26368311 2015 Feedback regulation through myosin II confers robustness on RhoA signalling at E-cadherin junctions.
26226608 Nonmuscle Myosin Heavy Chain IIA Mutation Predicts Severity and Progression of Sensorineural Hearing Loss in Patients With MYH9-Related Disease.
26152646 2015 Estimated glomerular filtration rate (eGFR), 25(OH) D3, chronic kidney disease (CKD), the MYH9 (myosin heavy chain 9) gene in old and very elderly people.
26147622 2015 In vivo Modeling Implicates APOL1 in Nephropathy: Evidence for Dominant Negative Effects and Epistasis under Anemic Stress.
26136073 2015 Non-Muscle Myosin II Isoforms Have Different Functions in Matrix Rearrangement by MDA-MB-231 Cells.
26056797 2015 Genotype-phenotype Correlation of the p.R1165C Mutation in the MYH9 Disorder: Report of a Japanese Pedigree.
26051904 2015 A novel MYH9 mutation in a patient with MYH9 disorders and platelet size-specific effect of romiplostim on macrothrombocytopenia.
More...