Property Summary

Ligand Count 5
NCBI Gene PubMed Count 73
PubMed Score 907.70
PubTator Score 317.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Glycogen storage disease 39 7.334 3.7

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.500 8.9e-05
atypical teratoid / rhabdoid tumor 1.200 2.3e-03
glioblastoma 1.300 1.5e-03
group 4 medulloblastoma 1.100 1.1e-02
medulloblastoma, large-cell 2.000 6.7e-06
nephrosclerosis -2.265 3.3e-02
ovarian cancer 1.300 8.8e-10

Gene RIF (37)

AA Sequence

MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDW      1 - 70
LNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQG     71 - 140
KIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYF    141 - 210
LITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY    211 - 280
RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLG    281 - 350
QPHKKSL                                                                   351 - 357
//

Text Mined References (87)

PMID Year Title