Property Summary

NCBI Gene PubMed Count 69
Grant Count 158
R01 Count 86
Funding $13,260,803.85
PubMed Score 870.25
PubTator Score 317.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -2.265 0.033
atypical teratoid / rhabdoid tumor 1.200 0.002
glioblastoma 1.300 0.001
medulloblastoma, large-cell 2.000 0.000
adult high grade glioma 1.500 0.000
group 4 medulloblastoma 1.100 0.011
ovarian cancer 1.300 0.000

Synonym

Accession P35575 A1L4C0 B4E1C3 K7EL82 G-6-Pase
Symbols G6PT
GSD1
G6PC1
GSD1a
G6Pase

Gene

Gene RIF (33)

PMID Text
26556724 ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose.
25001192 This study is the first to demonstrate a functional relationship between the critical gluconeogenic and glycogenolytic enzyme G6PC with the metabolic adaptations during glioblastoma invasion.
24980439 By direct DNA sequencing, three novel G6PC variations were identified which expanded the G6PC mutation spectrum, and provided conclusive genetic evidences for the definitive diagnosis of the Chinese patients.
24355556 The spectrum of mutations in the G6PC gene.
23755305 LSD1 regulates transcription activation of two gluconeogenic genes, FBP1 and G6Pase.
23465595 Lipopolysaccharide and monophosphoryl lipid A also up-regulated G6PC and PCK1 transcript abundance in a TLR4-dependent manner.
21983240 Both GSD-1a and G6PT strongly colocalised in perinuclear membranes. showed that GSD1 mutations did neither alter the G6PC or G6PT chimera localisation, nor the interaction between G6PT termini.
21733854 results reveal a novel link between glucose metabolism and the DNA damage signaling pathway and suggest a possible role for PEPCK and G6P in the DNA damage response
21328436 data mitigate against G6PD deficiency contributing to stroke risk in individuals with sickle cell anemia.
20509832 Observational study of genetic testing. (HuGE Navigator)
More...

AA Sequence

MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDW      1 - 70
LNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQG     71 - 140
KIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYF    141 - 210
LITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY    211 - 280
RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLG    281 - 350
QPHKKSL                                                                   351 - 357
//

Text Mined References (83)

PMID Year Title
26556724 2015 Interaction of ApoA-IV with NR4A1 and NR1D1 Represses G6Pase and PEPCK Transcription: Nuclear Receptor-Mediated Downregulation of Hepatic Gluconeogenesis in Mice and a Human Hepatocyte Cell Line.
25001192 2014 Glucose-6-phosphatase is a key metabolic regulator of glioblastoma invasion.
24980439 2015 Three novel mutations of the G6PC gene identified in Chinese patients with glycogen storage disease type Ia.
24355556 2014 A novel homozygous no-stop mutation in G6PC gene from a Chinese patient with glycogen storage disease type Ia.
23755305 2013 Suppression of gluconeogenic gene expression by LSD1-mediated histone demethylation.
23465595 2013 Toll-like receptor 4 signaling is required for induction of gluconeogenic gene expression by palmitate in human hepatic carcinoma cells.
21983240 2012 New insights into the organisation and intracellular localisation of the two subunits of glucose-6-phosphatase.
21733854 2011 DNA damage induces down-regulation of PEPCK and G6P gene expression through degradation of PGC-1alpha.
21328436 2011 G6PD deficiency and stroke in the CSSCD.
21109326 2011 Targeted deletion of liver glucose-6 phosphatase mimics glycogen storage disease type 1a including development of multiple adenomas.
More...