Property Summary

NCBI Gene PubMed Count 480
PubMed Score 1482.28
PubTator Score 986.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.083 1.5
Disease Target Count Z-score Confidence
Gestational diabetes 26 0.0 5.0

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 2.305 1.8e-02
acute quadriplegic myopathy -1.176 6.2e-03
adrenocortical carcinoma -1.335 9.2e-03
adult high grade glioma -1.100 1.4e-02
atypical teratoid / rhabdoid tumor 1.500 3.5e-03
Breast cancer -2.200 3.2e-06
breast carcinoma -1.100 5.0e-18
ductal carcinoma in situ -1.600 9.1e-03
group 4 medulloblastoma 1.200 1.8e-02
interstitial cystitis -1.100 5.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 5.3e-03
invasive ductal carcinoma -2.000 1.1e-02
malignant mesothelioma -1.500 3.6e-07
ovarian cancer -1.200 3.4e-02
posterior fossa group A ependymoma 1.100 5.4e-04
psoriasis -1.600 1.0e-07

Protein-protein Interaction (1)

Gene RIF (398)

AA Sequence

MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCF      1 - 70
NINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDGAAALGAGGGGGSCSGSS     71 - 140
GLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMN    141 - 210
IRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPI    211 - 280
SVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPS    281 - 350
TNRTHAHRHRGSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP    351 - 420
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPNGHYILSRGGN    421 - 490
GHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPP    491 - 560
GGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHRPDSSTLHTDDGYMPMSPGVAPVPSGRKGSG    561 - 630
DYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWT    631 - 700
NGVGGHHSHVLPHPKPPVESSGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRS    701 - 770
FKHTQRPGEPEEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH    771 - 840
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIEFGSDQSGYLS    841 - 910
GPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGVEMGRLGPAPPGAASICRPTR    911 - 980
AVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAEEVSLPRATMAAASSSSAASASPTGPQGA    981 - 1050
AELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFG   1051 - 1120
AGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQ   1121 - 1190
CPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ                     1191 - 1242
//

Text Mined References (486)

PMID Year Title