Property Summary

NCBI Gene PubMed Count 459
Grant Count 851
R01 Count 554
Funding $57,246,983.51
PubMed Score 1410.34
PubTator Score 986.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35568 IRS-1
Symbols HIRS-1

Gene

PDB

1IRS   1K3A   1QQG   2Z8C  

Gene RIF (378)

PMID Text
27143478 FRET-based translocation assays reveal that insulin promotes the association of both p62 and aPKC with the insulin-regulated scaffold IRS-1.
27005817 The G allele of rs13431554 in the IRS-1 gene was associated with a hyperreactive platelet phenotype in the coronary artery disease patients with T2DM.
26991655 IRS-specific gene signatures represent accurate surrogates of IGF activity and could predict response to anti-IGF therapy in breast cancer.
26684358 Upregulation of IRS1 was associated with metastasis of gastric carcinoma.
26620983 failed to find any association between the IRS1 Gly972Arg polymorphism and T2DM
26617742 miR-126 functions as a tumor suppressor in glioma cells by targeting IRS-1 expression via the PI3K/AKT signaling pathways
26604643 HCV NS5A favors serine phosphorylation of IRS-1, promoting insulin resistance through IRS-1 serine phosphorylation and increased gluconeogenesis.
26582067 rs1801278 in IRS1 gene may play a role in type 2 diabetes risk, especially in Asian and rs2943641 may be associated with type 2 diabetes risk in Caucasian.[meta-analysis]
26577117 High IRS1 Expression is associated with Colorectal Cancer.
26386696 hepatic insulin resistance in human obesity is: advanced; BMI-correlated; and involves aPKC-activating ceramide; aPKC levels and activity; IRS-1 levels, Akt activity, and FoxO1 phosphorylation; and increases in expression/abundance of PGC-1alpha
More...

AA Sequence

MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCF      1 - 70
NINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDGAAALGAGGGGGSCSGSS     71 - 140
GLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMN    141 - 210
IRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPI    211 - 280
SVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPS    281 - 350
TNRTHAHRHRGSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP    351 - 420
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPNGHYILSRGGN    421 - 490
GHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPP    491 - 560
GGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHRPDSSTLHTDDGYMPMSPGVAPVPSGRKGSG    561 - 630
DYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWT    631 - 700
NGVGGHHSHVLPHPKPPVESSGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRS    701 - 770
FKHTQRPGEPEEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH    771 - 840
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIEFGSDQSGYLS    841 - 910
GPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGVEMGRLGPAPPGAASICRPTR    911 - 980
AVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAEEVSLPRATMAAASSSSAASASPTGPQGA    981 - 1050
AELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFG   1051 - 1120
AGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQ   1121 - 1190
CPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ                     1191 - 1242
//

Text Mined References (465)

PMID Year Title
27143478 2016 Protein Scaffolds Control Localized Protein Kinase C? Activity.
27005817 2016 Association between insulin receptor substrate-1 polymorphisms and high platelet reactivity with clopidogrel therapy in coronary artery disease patients with type 2 diabetes mellitus.
26991655 2016 Insulin Receptor Substrate Adaptor Proteins Mediate Prognostic Gene Expression Profiles in Breast Cancer.
26684358 2016 MicroRNA-1225-5p inhibits proliferation and metastasis of gastric carcinoma through repressing insulin receptor substrate-1 and activation of ?-catenin signaling.
26620983 2015 Lack of association between the insulin receptor substrates-1 Gly972Arg polymorphism and type-2 diabetes mellitus among Saudis from Eastern Saudi Arabia.
26617742 2015 MicroRNA-126 acts as a tumor suppressor in glioma cells by targeting insulin receptor substrate 1 (IRS-1).
26604643 2015 Hepatitis C virus NS5A promotes insulin resistance through IRS-1 serine phosphorylation and increased gluconeogenesis.
26582067 2016 Associations between two single-nucleotide polymorphisms (rs1801278 and rs2943641) of insulin receptor substrate 1 gene and type 2 diabetes susceptibility: a meta-analysis.
26577117 2016 Survival Benefit of Exercise Differs by Tumor IRS1 Expression Status in Colorectal Cancer.
26386696 2015 BMI-related progression of atypical PKC-dependent aberrations in insulin signaling through IRS-1, Akt, FoxO1 and PGC-1? in livers of obese and type 2 diabetic humans.
More...