Property Summary

NCBI Gene PubMed Count 63
Grant Count 25
R01 Count 20
Funding $2,688,537.11
PubMed Score 191.22
PubTator Score 483.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -2.161 0.012
autosomal dominant Emery-Dreifuss muscul... 1.129 0.012
Atopic dermatitis -2.100 0.012
colon cancer -3.700 0.030
lung cancer 5.300 0.000
breast carcinoma -1.800 0.005
fibroadenoma -2.300 0.038
psoriasis -1.700 0.000
lung carcinoma 4.100 0.000
ductal carcinoma in situ -4.300 0.000
invasive ductal carcinoma -5.300 0.000
ulcerative colitis -5.200 0.000
pituitary cancer -6.400 0.000

Gene RIF (50)

PMID Text
26528723 an extended binding site in the catalytic cleft of cPEPCK which is used by 3-MPA to inhibit cPEPCK non-competitively.
25736587 Insulin-dependent translocation of FOXO1 regulated transcriptional repression of PCK1 concomitant with the formation of the FOXO1-euchromatic histone-lysine N-methyltransferase2 (EHMT2) complex and histone modifications of the PCK1 promoter region
24863970 A mutation of PCK1 associated with Smith-Magenis Syndrome, cytosolic PEPCK deficiency and NMDA receptor glutamate insensitivity.
23465595 Lipopolysaccharide and monophosphoryl lipid A also up-regulated G6PC and PCK1 transcript abundance in a TLR4-dependent manner.
23092637 The PCK1 tag-single nucleotide polymorphisms influenced insulin resistance by interacting with plasma n-3 polyunsaturated fatty acids levels in metabolic syndrome patients.
22489460 HCV core protein expression-mediated FOXO1 activation and the increased PGC-1alpha leaded to the elevation of PCK1 at the mRNA level
21726808 Acetylation regulates the stability of the gluconeogenic rate-limiting enzyme PEPCK1.
21152065 Studies demonstrate the association between PCK1 and smaller average brain volume.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20691246 Data show PEPCK-C and CPT-1 mRNAs are more abundant in non-tumoral tissues than in the tumoral counterpart, whereas the opposite occurred for the FAS gene.
More...

AA Sequence

MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLK      1 - 70
KYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMY     71 - 140
VIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGEFVKCLHSVGCPLPLQKPLVNNW    141 - 210
PCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYL    211 - 280
AAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKT    281 - 350
IQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW    351 - 420
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNF    421 - 490
GKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPK    491 - 560
EDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM            561 - 622
//

Text Mined References (68)

PMID Year Title
26528723 2015 Mixed Inhibition of cPEPCK by Genistein, Using an Extended Binding Site Located Adjacent to Its Catalytic Cleft.
25736587 2015 Translocation of forkhead box O1 to the nuclear periphery induces histone modifications that regulate transcriptional repression of PCK1 in HepG2 cells.
24863970 2014 Three rare diseases in one Sib pair: RAI1, PCK1, GRIN2B mutations associated with Smith-Magenis Syndrome, cytosolic PEPCK deficiency and NMDA receptor glutamate insensitivity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23465595 2013 Toll-like receptor 4 signaling is required for induction of gluconeogenic gene expression by palmitate in human hepatic carcinoma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23092637 2013 Gene-nutrient interactions on the phosphoenolpyruvate carboxykinase influence insulin sensitivity in metabolic syndrome subjects.
22489460 2012 [Hepatitis C virus core protein upregulates the transcription of PCK1 through FOXO1/PGC-1alpha pathway].
More...