Property Summary

NCBI Gene PubMed Count 67
PubMed Score 203.62
PubTator Score 483.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis -2.100 1.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.129 1.2e-02
breast carcinoma -1.800 4.7e-03
colon cancer -1.900 5.9e-03
ductal carcinoma in situ -4.300 2.7e-04
fibroadenoma -2.300 3.8e-02
invasive ductal carcinoma -5.300 2.5e-04
lung cancer 5.300 9.8e-07
lung carcinoma 4.100 7.2e-19
nephrosclerosis -2.161 1.2e-02
pituitary cancer -6.400 3.5e-16
psoriasis -1.400 1.2e-05
ulcerative colitis -5.200 6.3e-08

Gene RIF (53)

AA Sequence

MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLK      1 - 70
KYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMY     71 - 140
VIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGEFVKCLHSVGCPLPLQKPLVNNW    141 - 210
PCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYL    211 - 280
AAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKT    281 - 350
IQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW    351 - 420
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNF    421 - 490
GKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPK    491 - 560
EDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM            561 - 622
//

Text Mined References (72)

PMID Year Title