Property Summary

NCBI Gene PubMed Count 267
Grant Count 261
R01 Count 174
Funding $18,970,596.02
PubMed Score 738.64
PubTator Score 1037.16

Knowledge Summary

Patent (102,103)

Expression

  Differential Expression (2)

Disease log2 FC p
primitive neuroectodermal tumor -1.300 0.002
group 4 medulloblastoma -1.500 0.000

Synonym

Accession P35557 A4D2J2 A4D2J3 Q05810
Symbols GK
GLK
HK4
HHF3
HKIV
HXKP
LGLK
MODY2
FGQTL3

Gene

GCK

PDB

1GLK   1V4S   1V4T   3A0I   3F9M   3FGU   3FR0   3GOI   3H1V   3ID8   3IDH   3IMX   3QIC   3S41   3VEV   3VEY   3VF6   4DCH   4DHY   4ISE   4ISF   4ISG   4IWV   4IXC   4L3Q   4LC9   4MLE   4MLH   4NO7   4RCH  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
492951 confirmatory 77 / 0 / 115 Human Glck Counter Screen Assay

Gene RIF (241)

PMID Text
26620281 Given that acetylated GKRP may affiliate with type-2 diabetes mellitus (T2DM), understanding the mechanism of GKRP acetylation in the liver could reveal novel targets within the GK-GKRP pathway, for treating T2DM and other metabolic pathologies.
26283387 analysis of allosteric activation mechanisms in monomeric human glucokinase
26240958 DR of any degree was not present in our GCK-MODY group, while in spite of young age almost every fourth subject with HNF1A-MODY showed signs of this complication.
26226118 The results of this study showed that mutations in the GCK gene are the leading cause of maturity-onset diabetes of the young in our population
26208450 Thus, a glucokinase activator drug therapy may help MODY2 patients not in general, but seems to be a useful strategy for carriers of the L315H glucokinase mutation.
25987348 Plasma ghrelin is higher in glucokinase-maturity onset diabetes of the young than in the common polygenic forms of diabetes.
25935773 Patients had higher fasting and postprandial glycemic excursions in the first trimester of GCK mutation MODY pregnancies than HNF-1alpha mutation MODY pregnancies despite insulin treatment. There was an increased percentage of miscarriages in GCK pregnancies.
25892191 Aberrant methylation of the GCK gene body was significantly associated with the risk of essential hypertension.
25850297 Two novel GCK splicing mutations in Maturity Onset Diabetes of Young 2 have been characterized.
25633883 The meta-analysis showed that GCK-30G > A polymorphism was associated with GDM in Caucasian and Asian.
More...

AA Sequence

MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSE      1 - 70
VGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMK     71 - 140
HKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATM    141 - 210
ISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDES    211 - 280
SANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYN    281 - 350
ILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK    351 - 420
ERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ                             421 - 465
//

Text Mined References (268)

PMID Year Title
26620281 2015 Acetylation of glucokinase regulatory protein decreases glucose metabolism by suppressing glucokinase activity.
26283387 2015 Dual allosteric activation mechanisms in monomeric human glucokinase.
26240958 2015 Prevalence of Retinopathy in Adult Patients with GCK-MODY and HNF1A-MODY.
26226118 2015 Molecular diagnosis of maturity-onset diabetes of the young (MODY) in Turkish children by using targeted next-generation sequencing.
26208450 2015 Characterization of two MODY2 mutations with different susceptibility to activation.
25987348 2015 Circulating ghrelin level is higher in HNF1A-MODY and GCK-MODY than in polygenic forms of diabetes mellitus.
25935773 2015 The clinical management of hyperglycemia in pregnancy complicated by maturity-onset diabetes of the young.
25892191 2015 Aberrant methylation of the GCK gene body is associated with the risk of essential hypertension.
25850297 [Functional characterization of two novel splicing mutations in glucokinase gene in monogenic diabetes MODY2].
25633883 2015 Association of the glucokinase gene promoter polymorphism -30G > A (rs1799884) with gestational diabetes mellitus susceptibility: a case-control study and meta-analysis.
More...