Property Summary

NCBI Gene PubMed Count 75
Grant Count 338
R01 Count 189
Funding $39,008,241.47
PubMed Score 269.03
PubTator Score 397.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession P35548 D3DQN1 Q53XM4 Q9UD60
Symbols FPP
MSH
PFM
CRS2
HOX8
PFM1

Gene

 GO Component (1)

Gene RIF (45)

PMID Text
27088357 MSX2 protein expression is downregulated in placental villi from Pre-Eclampsia.
26427715 The MSX2 destabilizes the pluripotency circuitry through direct binding to the SOX2 promoter, while MSX2 controls mesendoderm lineage commitment by simultaneous suppression of SOX2 and induction of NODAL expression.
24666290 This is the first report of an eye development defect due to an increase in the MSX2 copy number in a human being.
24549638 SLUG and MSX2, transcription factors involved in epithelial-mesenchymal transitions, essential features of gastrulation in development and tumor progression, are important mediators of BMP4-induced differentiation in human embryonic stem cells.
23949913 These data confirm that missense mutations altering the proline at codon 148 of MSX2 cause dominantly inherited craniosynostosis.
22730815 Msx2 and topo II-alpha may play an important role in the occurrence and development of sinonasal inverted papilloma.
22717651 The pathogenic effect of the microduplications can best be explained by a misregulation of spatiotemporal MSX2 expression patterns in cleidocranial dysplasia.
22633971 PKC signaling modulates osteoblast differentiation, at least in part, through the regulation of Msx2.
22332551 Cyclic tensile stress may induce differentiation of periodontal ligament stem cells towards mineralized tissue cells by promoting Dlx5 mRNA expression and decreasing Msx2 expression.
21730974 MSX2 may be an important regulator of melanoma cell invasion and survival. Cytoplasmic expression of the protein was identified as biomarker for good prognosis in malignant melanoma.
More...

AA Sequence

MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA      1 - 70
SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHK     71 - 140
TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM    141 - 210
AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS                 211 - 267
//

Text Mined References (77)

PMID Year Title
27088357 2016 MSX2 Induces Trophoblast Invasion in Human Placenta.
26427715 2015 MSX2 mediates entry of human pluripotent stem cells into mesendoderm by simultaneously suppressing SOX2 and activating NODAL signaling.
24666290 2015 MSX2 Gene Duplication in a Patient with Eye Development Defects.
24549638 2014 BMP4 promotes EMT and mesodermal commitment in human embryonic stem cells via SLUG and MSX2.
23949913 2013 Boston type craniosynostosis: report of a second mutation in MSX2.
23918290 2013 Second family with the Boston-type craniosynostosis syndrome: novel mutation and expansion of the clinical spectrum.
22730815 2012 [Expression and significance of Msx2 and topo II-alpha in sinonasal inverted papilloma].
22717651 2012 Microduplications upstream of MSX2 are associated with a phenocopy of cleidocranial dysplasia.
22633971 2012 PKC signaling inhibits osteogenic differentiation through the regulation of Msx2 function.
22332551 2011 [Changes in the expression of Dlx5, Msx2, and Dlx5/Msx2 in hPDLSCs loaded with cyclic tensile stress].
More...