Property Summary

NCBI Gene PubMed Count 77
PubMed Score 277.81
PubTator Score 397.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.1
Disease Target Count Z-score Confidence
Craniosynostosis 74 6.224 3.1

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.903 1.5e-02
atypical teratoid / rhabdoid tumor 2.700 7.1e-03
colon cancer 1.500 3.3e-02
gastric carcinoma 1.400 3.4e-02
interstitial cystitis -1.600 3.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.9e-03
lung cancer 1.800 4.4e-03
malignant mesothelioma -2.500 7.5e-08
osteosarcoma 1.007 4.3e-02
pancreatic cancer 1.100 3.3e-04

 GO Component (2)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (46)

AA Sequence

MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA      1 - 70
SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHK     71 - 140
TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM    141 - 210
AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS                 211 - 267
//

Text Mined References (79)

PMID Year Title