Property Summary

NCBI Gene PubMed Count 23
PubMed Score 236.76
PubTator Score 133.66

Knowledge Summary

Patent

No data available

Synonym

Accession P35544 Q9H5V4
Symbols S30
FAU1
Fub1
Fubi
asr1
RPS30
MNSFbeta

Gene

FAU

PDB

2L7R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
22174317 HIV-1 Rev interacting protein, Finkel-Biskis-Reilly murine sarcoma virus ubiquitously expressed (FAU), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21550398 In 293T/17 cells, Bcl-G knockdown also attenuates UV-induced apoptosis, so that Bcl-G may constitute a common factor in the pathways by which both FAU and UV-irradiation induce apoptosis
19830698 data support a role for FAU in the regulation of platinum-resistance in ovarian cancer
19671159 siRNA-mediated downregulation of either Fau or Bcl-G expression inhibited apoptosis, and the inhibition produced by combining the two siRNAs was consistent with control of Bcl-G by Fau.
15543234 Overexpression of fau in the sense orientation induces cell death, which is inhibited both by Bcl-2 and by inhibition of caspases, in line with its proposed role in apoptosis
12860195 The C-terminal portion of the encoded protein displays antimicrobial activity against B. megaterium.
12660817 role in transforming osteogenic sarcoma cells to anchorage-independence

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGR      1 - 70
MLGG                                                                       71 - 74
//

Text Mined References (24)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21550398 2011 Candidate tumour suppressor Fau regulates apoptosis in human cells: an essential role for Bcl-G.
19830698 2010 FAU regulates carboplatin resistance in ovarian cancer.
19671159 2009 Dysregulated expression of Fau and MELK is associated with poor prognosis in breast cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15677445 2005 Distinct turnover of alternatively spliced isoforms of the RET kinase receptor mediated by differential recruitment of the Cbl ubiquitin ligase.
15635413 2005 Nucleolar proteome dynamics.
15543234 2004 Regulation of apoptosis by fau revealed by functional expression cloning and antisense expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12660817 2003 fau and its ubiquitin-like domain (FUBI) transforms human osteogenic sarcoma (HOS) cells to anchorage-independence.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8406491 1993 Assignment of the human FAU gene to a subregion of chromosome 11q13.
8395683 1993 fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as an antisense sequence in the Finkel-Biskis-Reilly murine sarcoma virus.
7821789 1994 Construction of a human full-length cDNA bank.
1326960 1992 Genomic structure and expression of the human fau gene: encoding the ribosomal protein S30 fused to a ubiquitin-like protein.