Property Summary

NCBI Gene PubMed Count 23
PubMed Score 236.76
PubTator Score 133.66

Knowledge Summary

Patent

No data available

Synonym

Accession P35544 Q9H5V4
Symbols S30
FAU1
Fub1
Fubi
asr1
RPS30
MNSFbeta

Gene

FAU

PDB

2L7R  

Gene RIF (7)

PMID Text
22174317 HIV-1 Rev interacting protein, Finkel-Biskis-Reilly murine sarcoma virus ubiquitously expressed (FAU), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21550398 In 293T/17 cells, Bcl-G knockdown also attenuates UV-induced apoptosis, so that Bcl-G may constitute a common factor in the pathways by which both FAU and UV-irradiation induce apoptosis
19830698 data support a role for FAU in the regulation of platinum-resistance in ovarian cancer
19671159 siRNA-mediated downregulation of either Fau or Bcl-G expression inhibited apoptosis, and the inhibition produced by combining the two siRNAs was consistent with control of Bcl-G by Fau.
15543234 Overexpression of fau in the sense orientation induces cell death, which is inhibited both by Bcl-2 and by inhibition of caspases, in line with its proposed role in apoptosis
12860195 The C-terminal portion of the encoded protein displays antimicrobial activity against B. megaterium.
12660817 role in transforming osteogenic sarcoma cells to anchorage-independence

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGR      1 - 70
MLGG                                                                       71 - 74
//

Text Mined References (24)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21550398 2011 Candidate tumour suppressor Fau regulates apoptosis in human cells: an essential role for Bcl-G.
19830698 2010 FAU regulates carboplatin resistance in ovarian cancer.
19671159 2009 Dysregulated expression of Fau and MELK is associated with poor prognosis in breast cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15677445 2005 Distinct turnover of alternatively spliced isoforms of the RET kinase receptor mediated by differential recruitment of the Cbl ubiquitin ligase.
15635413 2005 Nucleolar proteome dynamics.
15543234 2004 Regulation of apoptosis by fau revealed by functional expression cloning and antisense expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...