Property Summary

NCBI Gene PubMed Count 23
PubMed Score 258.84
PubTator Score 133.66

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGR      1 - 70
MLGG                                                                       71 - 74
//

Text Mined References (24)

PMID Year Title