Property Summary

NCBI Gene PubMed Count 23
PubMed Score 258.84
PubTator Score 133.66

Knowledge Summary

Patent

No data available

Synonym

Accession P35544 Q9H5V4
Symbols S30
FAU1
Fub1
Fubi
asr1
RPS30
MNSFbeta

Gene

FAU

PDB

2L7R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGR      1 - 70
MLGG                                                                       71 - 74
//

Text Mined References (24)

PMID Year Title