Property Summary

NCBI Gene PubMed Count 30
PubMed Score 61.74
PubTator Score 47.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.7e-08
Disease Target Count Z-score Confidence
Amyloidosis 67 3.495 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 2.7e-08

Gene RIF (8)

AA Sequence

MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGV      1 - 70
WAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY               71 - 130
//

Text Mined References (33)

PMID Year Title