Property Summary

NCBI Gene PubMed Count 30
PubMed Score 58.01
PubTator Score 47.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Amyloidosis 68 3.372 1.7
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession P35542 Q6FHJ4
Symbols CSAA
C-SAA

Gene

Gene RIF (8)

PMID Text
24951172 expressed in invasive trophoblast cells
23631828 Six apolipoproteins (APOA1, APOA2, APOB, APOC2, APOC3, and APOE) were able to differentiate bladder cancer from hernia. SAA4 was significantly increased in bladder cancer subgroups, whereas ProEGF was significantly decreased in bladder cancer subgroups.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20536400 studies provide the first evidence for a novel type of AA amyloidosis in which the fibrils were formed from a mutated SAA4 protein
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12410800 The sequences of 1478 and 1836 bp of the SAA1 and SAA4 5'-flanking regions were determined.

AA Sequence

MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGV      1 - 70
WAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY               71 - 130
//

Text Mined References (33)

PMID Year Title
24951172 2014 Expression of serum amyloid A4 in human trophoblast-like choriocarcinoma cell lines and human first trimester/term trophoblast cells.
23631828 2013 Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22028381 2011 Quantitative detection of single amino acid polymorphisms by targeted proteomics.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20536400 2009 AA amyloidosis associated with a mutated serum amyloid A4 protein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...