Property Summary

NCBI Gene PubMed Count 308
PubMed Score 2982.00
PubTator Score 713.78

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35520 B2R993 D3DSK4 Q99425 Q9BWC5
Symbols HIP4

Gene

CBS

PANTHER Protein Class (2)

PDB

1JBQ   1M54   4COO   4L0D   4L27   4L28   4L3V   4PCU   4UUU  

Gene RIF (277)

PMID Text
27039165 The H2S-producing enzyme cystathionine beta-synthase (CBS), sustaining cellular bioenergetics in colorectal cancer cells, plays a role in the interplay between gasotransmitters. (Review)
26867575 In addition to being a potential source of superoxide radical, CBS constitutes a previously unrecognized source of NO(*)and peroxynitrite.
26582199 AdoMet binding significantly enhances CBS inhibition by carbon monoxide.
26540672 In Asian populations, the investigated polymorphisms mapping at TCN2 and CBS genes did not provide any evidence of association with cleft lip/cleftpalate.
26519441 Study found a novel association of CD2AP with plasma homocysteine in participants with African ancestry and found a new variant in the candidate gene CBS associated with homocysteine
26460077 Cystathionine beta-synthase-derived hydrogen sulfide is involved in human malignant hyperthermia.
26452259 CBS is involved in regulating lipid metabolism in ovarian cancer cells.
26051168 CBS expression is elevated in breast cancer.
25873304 Results imply that in acute ischemic conditions, CBS is upregulated and activated by truncation causing an increased production of hydrogen sulfide, which exacerbate the ischemic injuries
25636110 CBS gene T833C CC genotype may be associated with the essential hypertension among Uyghur ethnics.
More...

AA Sequence

MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP      1 - 70
AKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGD     71 - 140
TIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRL    141 - 210
KNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGV    211 - 280
DPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSA    281 - 350
GSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS    351 - 420
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQI    421 - 490
RLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK             491 - 551
//

Text Mined References (320)

PMID Year Title
27039165 2016 Bioenergetic relevance of hydrogen sulfide and the interplay between gasotransmitters at human cystathionine ?-synthase.
26867575 2016 Kinetics of Nitrite Reduction and Peroxynitrite Formation by Ferrous Heme in Human Cystathionine ?-Synthase.
26582199 2016 S-Adenosyl-l-methionine Modulates CO and NO• Binding to the Human H2S-generating Enzyme Cystathionine ?-Synthase.
26540672 2016 Non-syndromic cleft lip with or without cleft palate in Asian populations: Association analysis on three gene polymorphisms of the folate pathway.
26519441 2016 Genetic Influences on Plasma Homocysteine Levels in African Americans and Yoruba Nigerians.
26460077 2016 Cystathionine ?-synthase-derived hydrogen sulfide is involved in human malignant hyperthermia.
26452259 2015 Role of cystathionine beta synthase in lipid metabolism in ovarian cancer.
26051168 2015 Role of cystathionine ?-synthase in human breast Cancer.
25873304 Cystathionine ?-synthase inhibition is a potential therapeutic approach to treatment of ischemic injury.
25636110 2015 [Association of cystathionine ?-synthase gene polymorphisms with essential hypertension in ethnic Uyghurs and Hans from Xinjiang].
More...