Property Summary

Ligand Count 1
NCBI Gene PubMed Count 325
PubMed Score 3246.06
PubTator Score 713.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Acquired scoliosis 281
Amblyopia 38
Amino acid level abnormal 2
Arachnodactyly 49
Arterial thrombosis 9
Autosomal recessive predisposition 1442
Biconcave vertebral bodies 9
Bipolar Disorder 666
Brain Ischemia 110
Brittle hair 25
Byzanthine arch palate 194
Cerebral Ischemia 37
Cerebrovascular accident 63
Congenital arteriovenous malformation 8
Congenital pectus carinatum 52
Curvature of spine 282
Cutis marmorata 32
Cystathionine beta-Synthase Deficiency Disease 1
Decreased joint mobility 53
Depressive disorder 409
Diabetes Mellitus, Non-Insulin-Dependent 145
Drug-induced depressive state 14
Dull intelligence 645
Ectopia Lentis 17
Embolism and Thrombosis 6
Epilepsy 792
Fractured hair 25
Fragile hair 25
Frequent fractures 53
Generalized osteoporosis with pathologic fractures 6
Glaucoma 239
Hernia, Inguinal 89
Hyperkyphosis 111
Hypertensive disease 292
Hypopigmentation disorder 25
Inadequate arch length for tooth size 45
Increase in blood pressure 119
Increased fracture rate 53
Intellectual disability 1016
Joint stiffness 84
Knee joint valgus deformity 56
Kyphoscoliosis deformity of spine 60
Kyphosis deformity of spine 114
Low intelligence 645
Marfanoid body habitus 11
Mental Retardation 645
Mental deficiency 645
Mitral Valve Prolapse Syndrome 39
Myocardial Infarction 151
Myopia 176
Osteoporosis 363
Pancreatitis 123
Pectus excavatum 100
Personality Disorders 7
Poor school performance 645
Pulmonary embolism 55
Reduced tensile strength of hair 25
Schizophrenia 1160
Seizures 596
Sparse scalp hair 42
Steatohepatitis 44
Tall stature 34
Thromboembolism 15
Tooth Crowding 45
Tooth mass arch size discrepancy 45
Tooth size discrepancy 45
Varying degree of multiple fractures 53
Venous Thrombosis 47
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 3.0
Disease Target Count
Classic homocystinuria 3

Expression

PDB (10)

Gene RIF (293)

AA Sequence

MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP      1 - 70
AKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGD     71 - 140
TIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRL    141 - 210
KNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGV    211 - 280
DPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSA    281 - 350
GSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS    351 - 420
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQI    421 - 490
RLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK             491 - 551
//

Text Mined References (337)

PMID Year Title