Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
Funding $200,423.2
PubMed Score 9.71
PubTator Score 3.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P35504 B8K294 UDPGT 1-5
Symbols UDPGT
UGT1E
UDPGT 1-5

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
18223459 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVVLTLEVNMYIK      1 - 70
EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNMSLIIHRSCVELLHNEALIRH     71 - 140
LHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFLQR    141 - 210
VKNMLYPLALSYLCHAVSAPYASLASELFQREVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (28)

PMID Year Title
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
More...