Property Summary

NCBI Gene PubMed Count 26
PubMed Score 9.49
PubTator Score 3.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Anemia 365 0.0 3.0
Disease Target Count Z-score Confidence
Pericholangitis 8 4.313 2.2
Bilirubin metabolic disorder 41 3.184 1.6
Disease Target Count
Sickle Cell Anemia 53

 HCA RNA Cell Line (3)

Gene RIF (4)

AA Sequence

MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVVLTLEVNMYIK      1 - 70
EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNMSLIIHRSCVELLHNEALIRH     71 - 140
LHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFLQR    141 - 210
VKNMLYPLALSYLCHAVSAPYASLASELFQREVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (28)

PMID Year Title