Property Summary

Ligand Count 2,360
NCBI Gene PubMed Count 356
PubMed Score 312.30
PubTator Score 382.09

Knowledge Summary

Patent (15,034)

TINX Plot

  Disease (7)

Gene RIF (381)

AA Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVS      1 - 70
LAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQH     71 - 140
GTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYAR    141 - 210
IYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREE    211 - 280
KTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHV    281 - 350
LNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC                        351 - 400
//

Text Mined References (359)

PMID Year Title