Property Summary

NCBI Gene PubMed Count 335
Grant Count 128
R01 Count 55
Funding $21,673,035.94
PubMed Score 303.42
PubTator Score 382.09

Knowledge Summary

Patent (15,034)

Synonym

Accession P35462 A1A4V5 Q4VBM8
Symbols D3DR
ETM1
FET1

Gene

PANTHER Protein Class (2)

PDB

3PBL  

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (25)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504410 confirmatory 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki Set 2
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652048 screening 2394 / 0 / 409679 qHTS of D3 Dopamine Receptor Agonist: qHTS
652049 summary 0 / 0 / 0 qHTS of D3 Dopamine Receptor Potentiators: Summary
More...

Gene RIF (360)

PMID Text
27077655 Ammonia induced autophagy by MTOR is mediated by DRD3.
26857559 The combination of MTHFR, DRD3 and MDR1 polymorphisms associated with a slow ATV metabolizer phenotype
26787837 Drd3 palmitoylation acts as a molecular switch for Drd3-biased signaling via a GIPC1-dependent route, which is likely to affect the mode of action of antipsychotic drugs.
26627941 The DRD3 (rs6280) polymorphism influences younger Parkinson disease age of onset in the US Caucasian population.
26561806 A significant positive correlation was found between the DRD3 mRNA level and the score of the excited factor in patients with schizophrenia/schizophreniform disorder.
26376054 Combined genetic polymorphisms related to dopamine neurotransmission, COMT Val158Met and DRD3 Ser9Gly, might influence executive function in schizophrenia.
26164205 data utilizing a dopamine agonist tracer demonstrate, for the first time, an inverse association between social status and D2/3R availability.
26116441 used site-directed mutagenesis to identify key residues involved in D3 receptor signaling function
25931118 results provide insights into the potential contribution of molecules of cholesterol to the overall organization and potential stability of the D3 receptor and possibly other GPCR quaternary structures
25927430 We did not find evidence of association between the other four SNPs (rs167771 and rs324029 in DRD3, rs8076005 and rs2066713 in SCL6A4) and Type 2 Diabetes Mellitus.
More...

AA Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVS      1 - 70
LAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQH     71 - 140
GTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYAR    141 - 210
IYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREE    211 - 280
KTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHV    281 - 350
LNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC                        351 - 400
//

Text Mined References (336)

PMID Year Title
27077655 2016 Ammonia Induces Autophagy through Dopamine Receptor D3 and MTOR.
26857559 2016 A pharmacogenetic pilot study reveals MTHFR, DRD3, and MDR1 polymorphisms as biomarker candidates for slow atorvastatin metabolizers.
26787837 2016 A GIPC1-Palmitate Switch Modulates Dopamine Drd3 Receptor Trafficking and Signaling.
26627941 2016 Association of Parkinson disease age of onset with DRD2, DRD3 and GRIN2B polymorphisms.
26561806 2015 The mRNA Expression Status of Dopamine Receptor D2, Dopamine Receptor D3 and DARPP-32 in T Lymphocytes of Patients with Early Psychosis.
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
26376054 Epistasis between COMT Val158Met and DRD3 Ser9Gly polymorphisms and cognitive function in schizophrenia: genetic influence on dopamine transmission.
26164205 2015 A preliminary study of dopamine D2/3 receptor availability and social status in healthy and cocaine dependent humans imaged with [(11)C](+)PHNO.
26116441 2015 Identification of key residues involved in the activation and signaling properties of dopamine D3 receptor.
25931118 2015 Analysis of Human Dopamine D3 Receptor Quaternary Structure.
More...