Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.86
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 0.00346442414503535
Disease Target Count Z-score Confidence
Polydactyly 93 4.269 2.1
Syndactyly 56 4.231 2.1
Clubfoot 35 3.095 1.5

Gene RIF (7)

PMID Text
20085705 In human embryonic stem cell (hESCs)differentiation, a 1.8kb region between HOXD11 and HOXD12 (D11.12) that is associated with PcG proteins was discovered, it shows alteration in nuclease sensitivity as hESCs differentiate.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19540081 data show no significant difference in HOXD11, HOXD12 & HOXD13 genotype frequencies between the autism spectrum disorder & healthy controls, but one SNP in promoter region of HOXD11 was observed in only 4 patients with ASD
19540081 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
16331564 Data show that HOXD12 are important susceptible genes of idiopathic congenital talipes equinovarus.
16331564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAPAQPAGATAFG      1 - 70
GFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFAPESSLAPAVAALKAAKYDYA     71 - 140
GVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAGVASCLRPSLPDGLPWGAAPGRARKKRKPYT    141 - 210
KQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLREQALALY              211 - 270
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20085705 2010 A region of the human HOXD cluster that confers polycomb-group responsiveness.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19540081 2010 Study of HOXD genes in autism particularly regarding the ratio of second to fourth digit length.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
17236141 2007 Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome.
16331564 2005 [Analysis of association between 5' HOXD gene and idiopathic congenital talipes equinovarus].
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...