Property Summary

NCBI Gene PubMed Count 85
PubMed Score 237.67
PubTator Score 130.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.300 2.3e-02
Astrocytoma, Pilocytic 1.500 1.3e-04
atypical teratoid/rhabdoid tumor -1.400 3.8e-04
Breast cancer 2.900 5.7e-12
esophageal adenocarcinoma 1.500 4.1e-02
gastric carcinoma 3.900 1.8e-02
glioblastoma 1.100 3.6e-03
group 3 medulloblastoma -1.800 7.8e-03
interstitial cystitis -1.800 2.8e-02
interstitial lung disease 1.100 3.5e-02
intraductal papillary-mucinous adenoma (... -3.000 1.3e-03
intraductal papillary-mucinous carcinoma... -3.200 5.3e-03
lung adenocarcinoma 1.200 2.5e-05
lung cancer 1.900 3.2e-05
malignant mesothelioma -4.700 4.2e-09
medulloblastoma, large-cell -1.400 7.4e-04
nasopharyngeal carcinoma 1.100 9.6e-04
non-small cell lung cancer 2.850 1.3e-18
ovarian cancer -1.900 2.0e-02
pancreatic cancer 1.800 4.8e-04
pancreatic ductal adenocarcinoma liver m... 2.246 1.9e-02
pituitary cancer -3.400 2.0e-06
psoriasis -1.400 6.3e-03

Protein-protein Interaction (11)

Gene RIF (68)

AA Sequence

MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNADD      1 - 70
LSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGPADTLDLTYWIDGTRHVVSLE     71 - 140
DVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFYEHLQAEKSRMYVAKGSARESHFRGLLQNVH    141 - 210
LVFENSVEDILSKKGCQQGQGAEINAISENTETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQEL    211 - 280
SGLHVLVNQLSENLKRVSNDNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTIC    281 - 350
HQITCPPATCASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI    351 - 420
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSGRETKACQGAP    421 - 490
CPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQERQMCNKRSCPVDGCLSNPCFP    491 - 560
GAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQ    561 - 630
PVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGW    631 - 700
PNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKD    701 - 770
EVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL    771 - 840
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRD    841 - 910
NCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWV    911 - 980
IRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYW    981 - 1050
EDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKT   1051 - 1120
GYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI                     1121 - 1172
//

Text Mined References (90)

PMID Year Title