Property Summary

NCBI Gene PubMed Count 77
Grant Count 138
R01 Count 67
Funding $18,015,510.79
PubMed Score 220.71
PubTator Score 130.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35442 A6H8N1 A7E232 Q5RI52
Symbols TSP2

Gene

PDB

1YO8   2RHP  

Gene RIF (61)

PMID Text
26235673 The level of THBS2 in differentiating stem cells, influences chondrogenic differentiation potential.
26168731 determined if structural differences of the TSPs imparted different effects on vascular smooth muscle cell functions critical to the formation of neointimal hyperplasia
25976449 No association was observed between the THBS2 3' untranslated region polymorphism and coronary artery disease risk.
25771974 Patients whose MPM tissues expressed elevated mRNA levels of BIRC5, DSP, NME2, and THBS2 showed a statistically significant shorter overall survival.
25262009 Study suggests THBS2 is aberrantly expressed in gastric cancer and plays a critical role in cancer progression.
24764155 THBS2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival.
24708169 THBS2 is a salivary biomarker of oral cavity squamous cell carcinoma.
24500070 TSP-2 is a potentially useful biomarker for assessment of disease severity and prognosis in HFrEF.
24374826 Estrogen receptor alpha in cancer-associated fibroblasts suppresses prostate cancer invasion via modulation of thrombospondin 2 and matrix metalloproteinase 3.
23875975 Variants within the thrombospondin 2 (THBS2) gene are not associated with Achilles tendinopathy
More...

AA Sequence

MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNADD      1 - 70
LSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGPADTLDLTYWIDGTRHVVSLE     71 - 140
DVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFYEHLQAEKSRMYVAKGSARESHFRGLLQNVH    141 - 210
LVFENSVEDILSKKGCQQGQGAEINAISENTETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQEL    211 - 280
SGLHVLVNQLSENLKRVSNDNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTIC    281 - 350
HQITCPPATCASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI    351 - 420
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSGRETKACQGAP    421 - 490
CPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQERQMCNKRSCPVDGCLSNPCFP    491 - 560
GAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQ    561 - 630
PVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGW    631 - 700
PNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKD    701 - 770
EVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL    771 - 840
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRD    841 - 910
NCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWV    911 - 980
IRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYW    981 - 1050
EDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKT   1051 - 1120
GYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI                     1121 - 1172
//

Text Mined References (82)

PMID Year Title
26235673 2015 Autocrine Action of Thrombospondin-2 Determines the Chondrogenic Differentiation Potential and Suppresses Hypertrophic Maturation of Human Umbilical Cord Blood-Derived Mesenchymal Stem Cells.
26168731 2015 Thrombospondin-1, -2 and -5 have differential effects on vascular smooth muscle cell physiology.
25976449 2015 Association between single nucleotide polymorphisms in thrombospondins genes and coronary artery disease: A meta-analysis.
25771974 2015 Expression status of candidate genes in mesothelioma tissues and cell lines.
25262009 2014 Down regulation of Thrombospondin2 predicts poor prognosis in patients with gastric cancer.
24764155 2015 Nodal metastasis and survival in oral cancer: Association with protein expression of SLPI, not with LCN2, TACSTD2, or THBS2.
24708169 2014 Secretome profiling of primary cells reveals that THBS2 is a salivary biomarker of oral cavity squamous cell carcinoma.
24500070 2014 Circulating thrombospondin-2 reflects disease severity and predicts outcome of heart failure with reduced ejection fraction.
24374826 2014 Estrogen receptor ? in cancer-associated fibroblasts suppresses prostate cancer invasion via modulation of thrombospondin 2 and matrix metalloproteinase 3.
23875975 2014 Variants within the COMP and THBS2 genes are not associated with Achilles tendinopathy in a case-control study of South African and Australian populations.
More...