Property Summary

Ligand Count 25
NCBI Gene PubMed Count 74
PubMed Score 279.13
PubTator Score 136.65

Knowledge Summary

Patent (20,816)


  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.300 2.7e-02
Astrocytoma, Pilocytic 1.600 1.8e-03
colon cancer 1.800 4.7e-04
ependymoma 2.000 2.0e-03
interstitial cystitis 1.900 1.5e-03
ovarian cancer 1.400 7.1e-10
Pick disease 1.600 4.3e-02
sonic hedgehog group medulloblastoma -1.500 5.0e-03

 CSPA Cell Line (2)

Gene RIF (67)

AA Sequence

SQGPGPNMGKGGEQMHEKSIPYSQETLVVD                                            351 - 380

Text Mined References (76)

PMID Year Title