Property Summary

NCBI Gene PubMed Count 8
PubMed Score 177.04
PubTator Score 38.17

Knowledge Summary

Patent (151)

Synonym

Accession P35410 Q5SUN5 MAS-R
Symbols MRG
MAS-L
dJ994E9.2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (2)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
18636314 Mas, MrgD, and MRG mediated Ang IV-stimulated AA release that was highest for Mas. While Ang III activated Mas and MrgX2, Ang II stimulated AA release via Mas and MRG.

AA Sequence

MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ      1 - 70
QALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGATNPYMVYILHLVAADVIYLCCSAVGFLQVTLLTYHG     71 - 140
VVFFIPDFLAILSPFSFEVCLCLLVAISTERCVCVLFPIWYRCHRPKYTSNVVCTLIWGLPFCINIVKSL    141 - 210
FLTYWKHVKACVIFLKLSGLFHAILSLVMCVSSLTLLIRFLCCSQQQKATRVYAVVQISAPMFLLWALPL    211 - 280
SVAPLITDFKMFVTTSYLISLFLIINSSANPIIYFFVGSLRKKRLKESLRVILQRALADKPEVGRNKKAA    281 - 350
GIDPMEQPHSTQHVENLLPREHRVDVET                                              351 - 378
//

Text Mined References (8)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18636314 2008 Angiotensin metabolites can stimulate receptors of the Mas-related genes family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.
1723144 1991 Cloning and functional characterization of a novel mas-related gene, modulating intracellular angiotensin II actions.