Property Summary

NCBI Gene PubMed Count 8
PubMed Score 198.04
PubTator Score 38.17

Knowledge Summary

Patent (151)

Expression

 HCA RNA Cell Line (1)

Gene RIF (2)

AA Sequence

MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ      1 - 70
QALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGATNPYMVYILHLVAADVIYLCCSAVGFLQVTLLTYHG     71 - 140
VVFFIPDFLAILSPFSFEVCLCLLVAISTERCVCVLFPIWYRCHRPKYTSNVVCTLIWGLPFCINIVKSL    141 - 210
FLTYWKHVKACVIFLKLSGLFHAILSLVMCVSSLTLLIRFLCCSQQQKATRVYAVVQISAPMFLLWALPL    211 - 280
SVAPLITDFKMFVTTSYLISLFLIINSSANPIIYFFVGSLRKKRLKESLRVILQRALADKPEVGRNKKAA    281 - 350
GIDPMEQPHSTQHVENLLPREHRVDVET                                              351 - 378
//

Text Mined References (8)

PMID Year Title