Property Summary

NCBI Gene PubMed Count 150
Grant Count 303
R01 Count 196
Funding $28,557,915.1
PubMed Score 922.90
PubTator Score 393.04

Knowledge Summary

Patent (38,513)

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Cancer 2,346 4.86 2.4
Patent ductus arteriosus 23 3.476 1.7
Endometriosis 535 3.461 1.7
Adenomatoid tumor 7 3.398 1.7
Inflammatory bowel disease 142 3.195 1.6
Arthritis 248 3.062 1.5
Vascular disease 281 3.038 1.5
Ankylosing spondylitis 138 2.0
Arthritis, Experimental 39
Bipolar Disorder 266
Brain cancer 21 1.0
Breast cancer 3,094
Cervical ripening procedure 9
Chloracne 32
Crohn's disease 304 1.0
Duchenne muscular dystrophy 602
Gaucher disease type 3 76
Hydatidiform mole, benign 9
Incomplete miscarriage 10
Induction of labor 10
Inflammation 109
Lymphoma 56
Malignant glioma 23 1.0
Multiple Sclerosis 498 2.0
Ovarian Cysts 34
Physiological Sexual Disorders 4
Pregnancy with abortive outcome 12
acute myeloid leukemia 780
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
esophageal adenocarcinoma 737
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087 2.0

Expression

Synonym

Accession P35408 Q3MJ87 PGE receptor EP4 subtype
Symbols EP4
EP4R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (21)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (119)

PMID Text
27010855 GW627368X therefore effectively inhibits cervical cancer survival, motility, proliferation and angiogenesis by blocking EP4/EGFR interactive signaling.
26689593 The cross-talk between SP1 and p65, and the positive feedback regulatory loop of PI3-K/Akt signaling by EP4 contribute to the overall responses of solamargine in this process
26538147 The PTGER4 gene is a candidate risk factor for radiological progression in rheumatoid arthritis
26188701 IP and EP4 receptors have a role in prostanoid regulation of angiogeneis
25733698 miRNA 526b is a COX-2 upregulated, oncogenic miRNA promoting stem-like cells, the expression of which follows EP4 receptor-mediated signaling.
25690101 TGF-beta2 therefore promotes the adhesion and invasiveness of virulent macrophages by modulating COX2, EP4, and PKIG transcription to initiate a prostaglandin E2 (PGE2)-driven autostimulatory loop that augments PKA and EPAC activities.
25670004 Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects.
25531811 Altered inhibitory function of the EP4R in eosinophils and monocytes from aspirin-intolerant patients
25329458 data show a protective role for the PGE2 receptors EP(2) and EP(4) following osmotic changes, through the reduction of human mast cell activity caused by calcium influx impairment and MAP kinase inhibition.
25109834 PGE2 upregulates c-myc in hepatocellular carcinoma via PTGER4 signaling.
More...

AA Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTL      1 - 70
LVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTL     71 - 140
FAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGAL    141 - 210
LRMHRQFMRRTSLGTEQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLV    211 - 280
VLICSIPLVVRVFVNQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCR    281 - 350
IGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG    351 - 420
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI      421 - 488
//

Text Mined References (150)

PMID Year Title
27010855 2016 GW627368X inhibits proliferation and induces apoptosis in cervical cancer by interfering with EP4/EGFR interactive signaling.
26689593 2015 Inactivation of PI3-K/Akt and reduction of SP1 and p65 expression increase the effect of solamargine on suppressing EP4 expression in human lung cancer cells.
26538147 2015 PTGER4 gene variant rs76523431 is a candidate risk factor for radiological joint damage in rheumatoid arthritis patients: a genetic study of six cohorts.
26188701 2015 Prostanoids regulate angiogenesis acting primarily on IP and EP4 receptors.
25733698 2015 COX-2 Elevates Oncogenic miR-526b in Breast Cancer by EP4 Activation.
25690101 2015 Transforming growth factor ?2 promotes transcription of COX2 and EP4, leading to a prostaglandin E2-driven autostimulatory loop that enhances virulence of Theileria annulata-transformed macrophages.
25670004 2015 Anti-inflammatory genes associated with multiple sclerosis: a gene expression study.
25531811 2014 Altered inhibitory function of the E-type prostanoid receptor 4 in eosinophils and monocytes from aspirin-intolerant patients.
25329458 2014 Prostaglandin E2 prevents hyperosmolar-induced human mast cell activation through prostanoid receptors EP2 and EP4.
25109834 2014 Prostaglandin E2 promotes the cell growth and invasive ability of hepatocellular carcinoma cells by upregulating c-Myc expression via EP4 receptor and the PKA signaling pathway.
More...