Property Summary

NCBI Gene PubMed Count 118
PubMed Score 139.19
PubTator Score 147.14

Knowledge Summary

Patent (36,075)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 6.99163660905254E-34
psoriasis 6685 4.25755977043482E-32
breast carcinoma 1614 9.16873330466848E-22
Breast cancer 3099 3.4596167284363E-12
non-small cell lung cancer 2798 8.7853880241304E-11
lung adenocarcinoma 2714 4.64083685101822E-10
cystic fibrosis 1670 6.45771482022497E-8
atypical teratoid / rhabdoid tumor 4369 8.12394610985387E-7
medulloblastoma, large-cell 6234 9.86060197971304E-6
ovarian cancer 8492 1.85792857172076E-5
acute quadriplegic myopathy 1157 2.25304947256826E-5
juvenile dermatomyositis 1189 9.89225608619126E-5
malignant mesothelioma 3163 1.09721536896062E-4
ulcerative colitis 2087 1.16858353439878E-4
dermatomyositis 967 2.01476687660711E-4
Atopic dermatitis 944 4.82551306514475E-4
Amyotrophic Lateral Sclerosis 432 5.52282821926642E-4
primitive neuroectodermal tumor 3031 0.00137850442717691
medulloblastoma 1524 0.00162722966193646
glioblastoma 5572 0.00262330718598776
adult high grade glioma 2148 0.00278045316205934
pituitary cancer 1972 0.00353028438696171
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00359706291050867
Pick disease 1893 0.00492317219490015
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00608105948025746
ependymoma 2514 0.0093824933704896
mucosa-associated lymphoid tissue lymphoma 480 0.0106991050857538
Waldenstrons macroglobulinemia 765 0.0112221821042842
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0120893263711288
invasive ductal carcinoma 2950 0.0147093597002091
pilocytic astrocytoma 3086 0.0191425040830202
esophageal adenocarcinoma 737 0.021800227927561
colon cancer 1475 0.0220487037914941
Hydrolethalus syndrome 128 0.0222045377471492
cutaneous lupus erythematosus 1056 0.0241268617328543
subependymal giant cell astrocytoma 2287 0.0261155614072911
spina bifida 1064 0.0389480712401109
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0419733682502592

Expression

Synonym

Accession P35398 P35397 P35399 P45445 Q495X4 Q96H83
Symbols ROR1
ROR2
ROR3
RZRA
NR1F1
RZR-ALPHA

Gene

PDB

4S15   1N83   1S0X  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
2139 summary 2 / 0 / 0 Summary of probe development efforts to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR).
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463078 other 1 / 0 / 5 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based assay to identify RORA inhibitors
463152 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify RORA inhibitors
504906 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): radioligand binding assay for RORa using [3H]25-hydroxycholesterol to determine whether probe candidates bind directly to RORa
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624277 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16

Gene RIF (81)

PMID Text
26731717 status epilepticus induced by pilocarpine is able to change the expression and daily variation of RORalpha in the rat hippocampal area during the acute and silent phases
26515929 A common SNP in the RORA gene (rs2899663) was associated with a 21% reduced odds of placental abruption.
26184991 In a Han Chinese population, an association between RORA gene variation and depression personality trait was found.
25953430 Identify RORalpha as being essential to drive inflammation in experimental epidermolysis bullosa acquisita.
25892098 The RORA intronic SNP rs11632098 was associated with greater odds of reporting depressive symptoms in older adults.
25826113 Retinoid-related orphan receptor alpha has gained attention as a new candidate in stress-related disorders, especially depression.
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
25668517 RORA rs12912233 alone might be a possible risk variant for epilepsy in Malaysian Chinese, but that, together with RORA rs880626 and SCN1A rs3812718, this polymorphism may have a synergistic effect in the epilepsy risk in Malaysians.
25500738 RORalpha and its target gene expressions are lower in colorectal tumor tissue compared with control colorectal tissue.
25362032 the data presented in this report are that RORA is linked in important ways to molecules that could be playing important roles in the AD etiology.
More...

AA Sequence

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI      1 - 70
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR     71 - 140
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE    141 - 210
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI    211 - 280
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN    281 - 350
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI    351 - 420
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA    421 - 490
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG                                         491 - 523
//

Text Mined References (128)

PMID Year Title
26731717 2016 Pilocarpine-induced epilepsy alters the expression and daily variation of the nuclear receptor ROR? in the hippocampus of rats.
26515929 2015 Circadian clock-related genetic risk scores and risk of placental abruption.
26184991 2015 Retinoid-related orphan receptor alpha (RORA) gene variation is associated with trait depression.
25953430 2015 The retinoid-related orphan receptor alpha is essential for the end-stage effector phase of experimental epidermolysis bullosa acquisita.
25892098 2015 Associations of PER3 and RORA Circadian Gene Polymorphisms and Depressive Symptoms in Older Adults.
25826113 2015 RNA expression profiling in depressed patients suggests retinoid-related orphan receptor alpha as a biomarker for antidepressant response.
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
25668517 2015 RORA gene rs12912233 and rs880626 polymorphisms and their interaction with SCN1A rs3812718 in the risk of epilepsy: a case-control study in Malaysia.
25500738 2015 ROR? inhibits adipocyte-conditioned medium-induced colorectal cancer cell proliferation and migration and chick embryo chorioallantoic membrane angiopoiesis.
25416956 2014 A proteome-scale map of the human interactome network.
More...