Tchem | Nuclear receptor ROR-alpha |
The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]
Comments
Disease | Target Count |
---|---|
Autistic Disorder | 320 |
Peripheral Neuropathy | 303 |
Stomach Neoplasms | 282 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Acquired metabolic disease | 267 | 0.0 | 1.0 |
Alzheimer's disease | 644 | 0.0 | 1.0 |
Asthma | 349 | 0.0 | 2.0 |
Mental depression | 58 | 0.0 | 1.0 |
Schizophrenia | 503 | 0.0 | 1.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Lown-Ganong-Levine syndrome | 3 | 4.213 | 2.1 |
Bipolar Disorder | 266 | 3.19 | 1.6 |
Seasonal affective disorder | 25 | 3.104 | 1.6 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
CHEMBL3617295
pEC50 7.07
CHEMBL3314003
pEC50 7.54
CHEMBL497834
pKi 7.92
CHEMBL497207
pKi 7.92
CHEMBL1278177
pKi 7.92
AID | Type | Active / Inconclusive / Inactive | Description |
---|---|---|---|
2139 | summary |
2 / 0 / 0 | Summary of probe development efforts to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR). |
2277 | screening |
14 / 0 / 0 | Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors. |
463078 | other |
1 / 0 / 5 | Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based assay to identify RORA inhibitors |
463152 | confirmatory |
1 / 0 / 0 | Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify RORA inhibitors |
504906 | other |
1 / 0 / 0 | Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): radioligand binding assay for RORa using [3H]25-hydroxycholesterol to determine whether probe candidates bind directly to RORa |
504934 | other |
1 / 0 / 0 | Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors |
624277 | other |
1 / 0 / 0 | Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters |
624279 | confirmatory |
1 / 0 / 0 | Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16 |
PMID | Text |
---|---|
26731717 | status epilepticus induced by pilocarpine is able to change the expression and daily variation of RORalpha in the rat hippocampal area during the acute and silent phases |
26515929 | A common SNP in the RORA gene (rs2899663) was associated with a 21% reduced odds of placental abruption. |
26184991 | In a Han Chinese population, an association between RORA gene variation and depression personality trait was found. |
25953430 | Identify RORalpha as being essential to drive inflammation in experimental epidermolysis bullosa acquisita. |
25892098 | The RORA intronic SNP rs11632098 was associated with greater odds of reporting depressive symptoms in older adults. |
25826113 | Retinoid-related orphan receptor alpha has gained attention as a new candidate in stress-related disorders, especially depression. |
25789810 | associations between NR1D1, RORA and RORB genes and bipolar disorder.( |
25668517 | RORA rs12912233 alone might be a possible risk variant for epilepsy in Malaysian Chinese, but that, together with RORA rs880626 and SCN1A rs3812718, this polymorphism may have a synergistic effect in the epilepsy risk in Malaysians. |
25500738 | RORalpha and its target gene expressions are lower in colorectal tumor tissue compared with control colorectal tissue. |
25362032 | the data presented in this report are that RORA is linked in important ways to molecules that could be playing important roles in the AD etiology. |
More... |
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI 1 - 70 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR 71 - 140 DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE 141 - 210 GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI 211 - 280 SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN 281 - 350 DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI 351 - 420 ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA 421 - 490 FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG 491 - 523 //
PMID | Year | Title |
---|---|---|
26731717 | 2016 | Pilocarpine-induced epilepsy alters the expression and daily variation of the nuclear receptor ROR? in the hippocampus of rats. |
26515929 | 2015 | Circadian clock-related genetic risk scores and risk of placental abruption. |
26184991 | 2015 | Retinoid-related orphan receptor alpha (RORA) gene variation is associated with trait depression. |
25953430 | 2015 | The retinoid-related orphan receptor alpha is essential for the end-stage effector phase of experimental epidermolysis bullosa acquisita. |
25892098 | 2015 | Associations of PER3 and RORA Circadian Gene Polymorphisms and Depressive Symptoms in Older Adults. |
25826113 | 2015 | RNA expression profiling in depressed patients suggests retinoid-related orphan receptor alpha as a biomarker for antidepressant response. |
25789810 | 2015 | Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder. |
25668517 | 2015 | RORA gene rs12912233 and rs880626 polymorphisms and their interaction with SCN1A rs3812718 in the risk of epilepsy: a case-control study in Malaysia. |
25500738 | 2015 | ROR? inhibits adipocyte-conditioned medium-induced colorectal cancer cell proliferation and migration and chick embryo chorioallantoic membrane angiopoiesis. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
More... |