Property Summary

NCBI Gene PubMed Count 118
Grant Count 52
R01 Count 19
Funding $4,668,784.02
PubMed Score 139.19
PubTator Score 147.14

Knowledge Summary

Patent (36,075)

TINX Plot

  Disease Relevance (49)

Expression

Synonym

Accession P35398 P35397 P35399 P45445 Q495X4 Q96H83
Symbols ROR1
ROR2
ROR3
RZRA
NR1F1
RZR-ALPHA

Gene

PDB

4S15   1N83   1S0X  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
2139 summary 2 / 0 / 0 Summary of probe development efforts to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR).
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463078 other 1 / 0 / 5 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based assay to identify RORA inhibitors
463152 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based dose response assay to identify RORA inhibitors
504906 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): radioligand binding assay for RORa using [3H]25-hydroxycholesterol to determine whether probe candidates bind directly to RORa
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624277 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16

Gene RIF (81)

PMID Text
26731717 status epilepticus induced by pilocarpine is able to change the expression and daily variation of RORalpha in the rat hippocampal area during the acute and silent phases
26515929 A common SNP in the RORA gene (rs2899663) was associated with a 21% reduced odds of placental abruption.
26184991 In a Han Chinese population, an association between RORA gene variation and depression personality trait was found.
25953430 Identify RORalpha as being essential to drive inflammation in experimental epidermolysis bullosa acquisita.
25892098 The RORA intronic SNP rs11632098 was associated with greater odds of reporting depressive symptoms in older adults.
25826113 Retinoid-related orphan receptor alpha has gained attention as a new candidate in stress-related disorders, especially depression.
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
25668517 RORA rs12912233 alone might be a possible risk variant for epilepsy in Malaysian Chinese, but that, together with RORA rs880626 and SCN1A rs3812718, this polymorphism may have a synergistic effect in the epilepsy risk in Malaysians.
25500738 RORalpha and its target gene expressions are lower in colorectal tumor tissue compared with control colorectal tissue.
25362032 the data presented in this report are that RORA is linked in important ways to molecules that could be playing important roles in the AD etiology.
More...

AA Sequence

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI      1 - 70
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR     71 - 140
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE    141 - 210
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI    211 - 280
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN    281 - 350
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI    351 - 420
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA    421 - 490
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG                                         491 - 523
//

Text Mined References (128)

PMID Year Title
26731717 2016 Pilocarpine-induced epilepsy alters the expression and daily variation of the nuclear receptor ROR? in the hippocampus of rats.
26515929 2015 Circadian clock-related genetic risk scores and risk of placental abruption.
26184991 2015 Retinoid-related orphan receptor alpha (RORA) gene variation is associated with trait depression.
25953430 2015 The retinoid-related orphan receptor alpha is essential for the end-stage effector phase of experimental epidermolysis bullosa acquisita.
25892098 2015 Associations of PER3 and RORA Circadian Gene Polymorphisms and Depressive Symptoms in Older Adults.
25826113 2015 RNA expression profiling in depressed patients suggests retinoid-related orphan receptor alpha as a biomarker for antidepressant response.
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
25668517 2015 RORA gene rs12912233 and rs880626 polymorphisms and their interaction with SCN1A rs3812718 in the risk of epilepsy: a case-control study in Malaysia.
25500738 2015 ROR? inhibits adipocyte-conditioned medium-induced colorectal cancer cell proliferation and migration and chick embryo chorioallantoic membrane angiopoiesis.
25416956 2014 A proteome-scale map of the human interactome network.
More...