Property Summary

Ligand Count 5
NCBI Gene PubMed Count 130
PubMed Score 154.66
PubTator Score 147.14

Knowledge Summary

Patent (36,075)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lown-Ganong-Levine syndrome 3 4.157 2.1

Expression

  Differential Expression (38)

Disease log2 FC p
acute quadriplegic myopathy 2.008 2.3e-05
adult high grade glioma -1.700 1.8e-03
Amyotrophic lateral sclerosis 1.061 5.5e-04
Astrocytoma, Pilocytic -1.100 1.3e-02
Atopic dermatitis -1.100 4.1e-03
atypical teratoid / rhabdoid tumor -2.500 1.7e-06
Breast cancer -1.500 2.7e-08
breast carcinoma -1.100 9.2e-22
colon cancer -1.400 2.2e-02
cutaneous lupus erythematosus -1.400 2.4e-02
cystic fibrosis 1.020 3.9e-04
dermatomyositis 1.900 2.0e-04
ependymoma -1.100 9.4e-03
esophageal adenocarcinoma -1.700 2.2e-02
glioblastoma -1.300 4.3e-03
group 4 medulloblastoma -1.700 6.1e-03
Hydrolethalus syndrome 1.670 2.2e-02
intraductal papillary-mucinous adenoma (... -1.900 6.2e-03
intraductal papillary-mucinous carcinoma... -3.000 5.4e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.0e-02
invasive ductal carcinoma -1.200 1.5e-02
juvenile dermatomyositis 1.393 7.0e-05
lung adenocarcinoma -1.700 4.6e-10
malignant mesothelioma -1.100 1.1e-04
medulloblastoma, large-cell -3.000 1.3e-05
mucosa-associated lymphoid tissue lympho... 1.213 1.1e-02
non-small cell lung cancer -1.253 8.8e-11
ovarian cancer -1.500 1.5e-07
pancreatic ductal adenocarcinoma liver m... -1.989 6.1e-03
periodontitis -1.400 7.0e-34
Pick disease 1.500 4.9e-03
pituitary cancer -1.100 3.5e-03
primitive neuroectodermal tumor -1.800 1.8e-03
psoriasis -1.200 4.3e-32
spina bifida -2.694 3.9e-02
subependymal giant cell astrocytoma -2.237 2.6e-02
ulcerative colitis 1.700 1.2e-04
Waldenstrons macroglobulinemia -1.103 4.7e-02

 GO Component (2)

Protein-protein Interaction (3)

Gene RIF (93)

AA Sequence

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI      1 - 70
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR     71 - 140
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE    141 - 210
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI    211 - 280
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN    281 - 350
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI    351 - 420
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA    421 - 490
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG                                         491 - 523
//

Text Mined References (140)

PMID Year Title