Property Summary

NCBI Gene PubMed Count 433
Grant Count 1,375
R01 Count 703
Funding $229,984,356.96
PubMed Score 1609.20
PubTator Score 1271.57

Knowledge Summary

Patent (90,709)

TINX Plot

  Disease Relevance (79)

Disease Z-score Confidence
Pain agnosia 99 6.938 3.5
Alcohol dependence 107 5.604 2.8
Opiate dependence 12 4.965 2.5
Withdrawal disorder 19 4.601 2.3
Nicotine dependence 53 4.045 2.0
Substance abuse 55 3.878 1.9
Constipation 43 3.687 1.8
Cancer 2,346 3.263 1.6
Histrionic personality disorder 3 3.231 1.6
Mucopolysaccharidosis IV 5 3.225 1.6
Tetanus neonatorum 7 3.1 1.5
Acute postoperative pain 6
Alcoholic Intoxication, Chronic 41
Alcoholism 14
Allergic rhinitis 91
Amphetamine-Related Disorders 74
Anxiety due to Cardiac Asthma 3
Breakthrough Pain in Opioid Tolerant Pat... 1 
Carcinoma 2,147 1.0
Chronic Lymphocytic Leukemia 242
Chronic Pain with Opioid Tolerance 6
Chronic pain 9
Cocaine-Related Disorders 88
Common cold 63
Cough 21
Diarrhea 155
Diarrhea Secondary to Inflammatory Bowel... 1 
Dyskinetic syndrome 6
Epilepsy 346
Fever 34
General anesthesia 53
Headache disorder 20
Hepatic encephalopathy 25
Hepatitis C 90
Heroin dependence 30
Hyperalgesia 71
Hypotension, Orthostatic 3
Idiopathic generalized epilepsy 15
Influenza-like symptoms 17
Irritable bowel syndrome with diarrhea 3
Labor pain 4
Local anesthesia 40
Moderate pain 1
Morphine dependence 19
Movement Disorders 21
Muscle Spasm with Pain 3
Nasal congestion 24
Nasal discharge 26
Neuralgia 16
Obesity 616
Opiate-Induced Respiratory Depression 4
Opioid dependence 4
Opioid withdrawal 2
Osteoarthritis 96
Pain 70
Poisoning by opiate analgesic drug 4
Postoperative ileus 1
Postoperative pain 1
Prevention of opioid abuse 5
Psychoses, Substance-Induced 17
Regional Anesthesia for Labor Pain 9
Regional Anesthesia for Postoperative Pa... 9 
Regional Anesthesia for Surgery 9
Rhinitis 46
Sedation as Adjunct to Anesthesia 15
Seizures 95
Severe Pain with Opioid Tolerance 3
Severe pain 12
Sneezing 11
Sore throat symptom 12
Tension-type headache 10
Therapeutic opioid induced constipation 3
Traveler's diarrhea 1
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
glioblastoma 5,572
medulloblastoma, large-cell 6,234
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.023 0.000
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 1.300 0.001
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.300 0.007
ovarian cancer 1.900 0.000

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (32)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
588435 confirmatory 16 / 0 / 213 Counterscreen for agonists of heterodimerization of the mu 1 (OPRM1) and delta 1 (OPRD1) opioid receptors: Luminescence-based cell-based high throughput dose response assay to identify agonists of OPRM1 homodimerization
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (468)

PMID Text
26692286 data provide evidence for genetic modulation of opioid withdrawal severity.
26633001 siRNA-loaded RVG exosomes significantly reduced MOR mRNA and protein levels. Surprisingly, MOR siRNA delivered by the RVG exosomes strongly inhibited morphine relapse via the down-regulation of MOR expression
26558451 result indicated that Caucasians carrying the G allele (AG + GG) of the A118G polymorphism in the mu-opioid receptor gene were more likely to be addicted to smoking compared with those with the AA homozygote
26553431 we have identified for the first time a potential mechanism that involves the essential splicing factor ASF/SF2 through which morphine regulates splicing specificity of the MOR encoding gene, OPRM1.
26489634 No association has been found between the OPRM1 A118G SNP and pain perception in Chinese cancer patients.
26478196 Individuals with the G/G genotype have been shown to have significantly higher preferences for sweet and fatty foods, which correlated with measures of overeating and BMI.
26449981 OPRM1 A118G was not associated with nicotine craving in adolescent novice smokers.
26415297 SNPs of OPRM1 118A>G and COMT 1947G>A affect the preoperative patients psychological status.
26233486 findings suggest that SNPs in opioid receptors and the PNOC genes are associated with NAS severity.
26228411 This study showed that One gene x gene interaction, 5-HTTLPR variant of the serotonin transporter (SERT/SLC6A4) in combination with mu opioid receptor (OPRM1, rs1799971) was associated with comorbid depression and conduct problems.
More...

AA Sequence

MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITA      1 - 70
ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTI     71 - 140
LCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATT    141 - 210
KYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRI    211 - 280
TRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFR    281 - 350
EFCIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP                        351 - 400
//

Text Mined References (443)

PMID Year Title
26692286 2016 Searching for evidence of genetic mediation of opioid withdrawal by opioid receptor gene polymorphisms.
26633001 2015 Targeted exosome-mediated delivery of opioid receptor Mu siRNA for the treatment of morphine relapse.
26558451 2015 Association of A118G polymorphism in the ?-opioid receptor gene with smoking behaviors: a meta-analysis.
26553431 2016 Morphine-induced MOR-1X and ASF/SF2 Expressions Are Independent of Transcriptional Regulation: Implications for MOR-1X Signaling.
26489634 2015 Association of single nucleotide polymorphisms of ABCB1, OPRM1 and COMT with pain perception in cancer patients.
26478196 2015 Genetic Similarities between Compulsive Overeating and Addiction Phenotypes: A Case for "Food Addiction"?
26449981 2015 Parental smoke exposure and the development of nicotine craving in adolescent novice smokers: the roles of DRD2, DRD4, and OPRM1 genotypes.
26415297 [M1-OPIOID RECEPTOR AND CATECHOL-O-METILTRANSFERASE GENES POLYMORPHISM EFFECTS ON PERIOPERATIVE PSYCHOLOGICAL CONDITION OF THE PATIENTS AND THE EFFECTIVENESS OF POSTOPERATIVE ANALGESIA WITH OPIOIDS].
26233486 2015 Variations in opioid receptor genes in neonatal abstinence syndrome.
26228411 2015 Examining gene-environment interactions in comorbid depressive and disruptive behavior disorders using a Bayesian approach.
More...