Property Summary

Ligand Count 589
NCBI Gene PubMed Count 67
PubMed Score 201.54
PubTator Score 139.26

Knowledge Summary

Patent (1,635)

TINX Plot

  Disease (6)

Disease Target Count
Mood Disorders 184
Disease Target Count P-value
psoriasis 6694 2.5e-35
medulloblastoma, large-cell 6241 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ureter carcinoma 2 3.772 1.9
Ureterolithiasis 4 3.557 1.8
Hyperekplexia 16 3.433 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 3.1e-03
psoriasis -1.900 2.5e-35

 GWAS Trait (2)

Gene RIF (46)

AA Sequence

MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSV      1 - 70
ACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAIS     71 - 140
IDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLG    141 - 210
SFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIA    211 - 280
VKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPC    281 - 350
SSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT    351 - 420
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGG    421 - 490
ASNGGCEAAADVANGQPGFKSNMPLAPGQF                                            491 - 520
//

Text Mined References (69)

PMID Year Title