Property Summary

NCBI Gene PubMed Count 64
PubMed Score 198.37
PubTator Score 139.26

Knowledge Summary

Patent (1,635)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.54543456008259E-35
medulloblastoma, large-cell 6234 0.00312843938077004
Disease Target Count Z-score Confidence
Ureter carcinoma 2 3.755 1.9
Ureterolithiasis 4 3.57 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.003
psoriasis -1.900 0.000

Synonym

Accession P35368 B0LPE1
Symbols ADRA1
ALPHA1BAR

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (44)

PMID Text
26497985 eIF3f/alpha adrenergic receptor interaction
25775528 heteromeric receptor complexes between alpha1A-AR and CXCR4 and between alpha1B-AR and CXCR4 are constitutively expressed in rat and human vascular smooth muscle cells; the quaternary structure of the receptor complex is important for signaling and contraction
24844469 alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts.
23877383 Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively.
23717684 alpha1B-AR signals through calcium, ERK1/2 and p38 only when located in the membrane and the signals disappear by membrane disruption.
23061915 Noradrenaline facilitated cell proliferation by regulation of potassium currents in human osteoblasts via G(i/o) -protein-coupled alpha(1B) -adrenoceptors, not via coupling to Gq-proteins
23052569 A rare ADRA1B haplotype composed of six single nucleotide polymorphism(SNP)s is associated with attention deficit hyperactivity disorder (ADHD).
22723743 Through beta-D receptor heteromers dopamine inhibits adrenergic receptor signaling and blocks the synthesis of melatonin induced by adrenergic receptor ligands.
22019450 Data show that sphingosine 1-phosphate can induce alpha1B-adrenergic receptor internalization and that its autocrine/paracrine generation is relevant for internalization induced by IGF-I.
21298476 alpha1b and alpha2c AR is over-expressed in basal-like breast tumours of poor prognosis
More...

AA Sequence

MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSV      1 - 70
ACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAIS     71 - 140
IDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLG    141 - 210
SFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIA    211 - 280
VKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPC    281 - 350
SSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT    351 - 420
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGG    421 - 490
ASNGGCEAAADVANGQPGFKSNMPLAPGQF                                            491 - 520
//

Text Mined References (66)

PMID Year Title
26497985 2015 The eukaryotic translation initiation factor 3f (eIF3f) interacts physically with the alpha 1B-adrenergic receptor and stimulates adrenoceptor activity.
25775528 2015 Heteromerization of chemokine (C-X-C motif) receptor 4 with ?1A/B-adrenergic receptors controls ?1-adrenergic receptor function.
24844469 2014 The stimulatory effects of alpha1-adrenergic receptors on TGF-beta1, IGF-1 and hyaluronan production in human skin fibroblasts.
23877383 2013 The presence and distribution of alpha adrenergic receptors in human renal pelvis and calyces.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23717684 2013 Differences in the signaling pathways of ?(1A)- and ?(1B)-adrenoceptors are related to different endosomal targeting.
23061915 2013 Noradrenaline stimulates cell proliferation by suppressing potassium channels via G(i/o) -protein-coupled ?(1B) -adrenoceptors in human osteoblasts.
23052569 2013 A high density linkage disequilibrium mapping in 14 noradrenergic genes: evidence of association between SLC6A2, ADRA1B and ADHD.
22723743 2012 Circadian-related heteromerization of adrenergic and dopamine D? receptors modulates melatonin synthesis and release in the pineal gland.
22120526 2012 Nuclear localization drives ?1-adrenergic receptor oligomerization and signaling in cardiac myocytes.
More...