Property Summary

NCBI Gene PubMed Count 64
Grant Count 22
R01 Count 19
Funding $2,281,583.87
PubMed Score 198.37
PubTator Score 139.26

Knowledge Summary

Patent (1,635)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.003
psoriasis -1.900 0.000

 GWAS Trait (1)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (44)

PMID Text
26497985 eIF3f/alpha adrenergic receptor interaction
25775528 heteromeric receptor complexes between alpha1A-AR and CXCR4 and between alpha1B-AR and CXCR4 are constitutively expressed in rat and human vascular smooth muscle cells; the quaternary structure of the receptor complex is important for signaling and contraction
24844469 alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts.
23877383 Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively.
23717684 alpha1B-AR signals through calcium, ERK1/2 and p38 only when located in the membrane and the signals disappear by membrane disruption.
23061915 Noradrenaline facilitated cell proliferation by regulation of potassium currents in human osteoblasts via G(i/o) -protein-coupled alpha(1B) -adrenoceptors, not via coupling to Gq-proteins
23052569 A rare ADRA1B haplotype composed of six single nucleotide polymorphism(SNP)s is associated with attention deficit hyperactivity disorder (ADHD).
22723743 Through beta-D receptor heteromers dopamine inhibits adrenergic receptor signaling and blocks the synthesis of melatonin induced by adrenergic receptor ligands.
22019450 Data show that sphingosine 1-phosphate can induce alpha1B-adrenergic receptor internalization and that its autocrine/paracrine generation is relevant for internalization induced by IGF-I.
21298476 alpha1b and alpha2c AR is over-expressed in basal-like breast tumours of poor prognosis
More...

AA Sequence

MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSV      1 - 70
ACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAIS     71 - 140
IDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLG    141 - 210
SFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIA    211 - 280
VKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPC    281 - 350
SSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT    351 - 420
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGG    421 - 490
ASNGGCEAAADVANGQPGFKSNMPLAPGQF                                            491 - 520
//

Text Mined References (66)

PMID Year Title
26497985 2015 The eukaryotic translation initiation factor 3f (eIF3f) interacts physically with the alpha 1B-adrenergic receptor and stimulates adrenoceptor activity.
25775528 2015 Heteromerization of chemokine (C-X-C motif) receptor 4 with ?1A/B-adrenergic receptors controls ?1-adrenergic receptor function.
24844469 2014 The stimulatory effects of alpha1-adrenergic receptors on TGF-beta1, IGF-1 and hyaluronan production in human skin fibroblasts.
23877383 2013 The presence and distribution of alpha adrenergic receptors in human renal pelvis and calyces.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23717684 2013 Differences in the signaling pathways of ?(1A)- and ?(1B)-adrenoceptors are related to different endosomal targeting.
23061915 2013 Noradrenaline stimulates cell proliferation by suppressing potassium channels via G(i/o) -protein-coupled ?(1B) -adrenoceptors in human osteoblasts.
23052569 2013 A high density linkage disequilibrium mapping in 14 noradrenergic genes: evidence of association between SLC6A2, ADRA1B and ADHD.
22723743 2012 Circadian-related heteromerization of adrenergic and dopamine D? receptors modulates melatonin synthesis and release in the pineal gland.
22120526 2012 Nuclear localization drives ?1-adrenergic receptor oligomerization and signaling in cardiac myocytes.
More...