Property Summary

NCBI Gene PubMed Count 93
PubMed Score 1011.40
PubTator Score 148.74

Knowledge Summary

Patent (9,225)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 9.60069454863538E-6
osteosarcoma 7933 4.10306679025279E-5
pilocytic astrocytoma 3086 1.37846160645506E-4
glioblastoma 5572 2.14528943755728E-4
pediatric high grade glioma 2712 2.24991897547672E-4
pancreatic cancer 2300 3.02500876599954E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00209094809274913
medulloblastoma 1524 0.00220577408066733
ovarian cancer 8492 0.00680318042337155
invasive ductal carcinoma 2950 0.00681865590175019
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0145093198816115
chronic kidney disease 90 0.018391824385903
lung cancer 4473 0.019995653729757
ependymoma 2514 0.020556566199575

Expression

  Differential Expression (14)

Synonym

Accession P35367 A8K047 Q6P9E5 H1R
Symbols H1R
H1-R
HH1R
hisH1

Gene

PANTHER Protein Class (2)

PDB

3RZE  

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

 GWAS Trait (1)

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (71)

PMID Text
26752109 HRH1-mediated sensitization of TRPV1 is involved in IBS. Ebastine, an antagonist of HRH1, reduced visceral hypersensitivity, symptoms, and abdominal pain in patients with IBS.
26635083 Activation of the H1R by its full agonists resulted in a composite potentiating effect. Intriguingly, inactivation of the Gaq-PLC pathway by H1R inverse agonists resulted also in a potentiation of GR activity.
25909280 HRH1-17 TT and HNMT-1639 TT genotypes were associated with the allergic asthma phenotype among African-American children and that the ABP 4107 GG genotype was associated with nonallergic asthma among white children.
25664905 Thus, the results in the initial study were due to the degradation of histamine in skeletal muscle by ascorbate, because the histaminergic vasodilatation was unaffected by N-acetylcysteine.
25582918 multiple signaling pathways contribute to histamine-induced endothelial barrier dysfunction via the H1 receptor.
25293806 HRH1 transcript was significantly down-modulated in multiple sclerose compared with health control.
24535227 The relationship between the expression of HRH1 and prognosis was found to vary in different types of cancers, even in the same cancer from different databases.
24236486 But carriers of one or three copies of HRH1 (5% of individuals), HRH2 (1.1%) and HRH4 genes (0.9%) were also identified.
23962049 Overexpression of H1R further increases the oxidative output of Duox-expressing HEK-293 cells.
23900020 Histamine demonstrably inhibited ACh-induced sweating in both mice and humans via H1R-mediated signaling.
More...

AA Sequence

MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLS      1 - 70
VADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRT     71 - 140
KTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFY    141 - 210
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP    211 - 280
KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ    281 - 350
MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI    351 - 420
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS       421 - 487
//

Text Mined References (100)

PMID Year Title
26752109 2016 Histamine Receptor H1-Mediated Sensitization of TRPV1 Mediates Visceral Hypersensitivity and Symptoms in Patients With Irritable Bowel Syndrome.
26635083 2015 Effects of histamine H1 receptor signaling on glucocorticoid receptor activity. Role of canonical and non-canonical pathways.
25909280 2015 Genetic Variation along the Histamine Pathway in Children with Allergic versus Nonallergic Asthma.
25664905 2015 Effect of antioxidants on histamine receptor activation and sustained postexercise vasodilatation in humans.
25582918 2015 Involvement of the H1 Histamine Receptor, p38 MAP Kinase, Myosin Light Chains Kinase, and Rho/ROCK in Histamine-Induced Endothelial Barrier Dysfunction.
25295384 2015 Genetic variation within the histamine pathway among patients with asthma--a pilot study.
25293806 2014 Gene expression analysis of histamine receptors in peripheral blood mononuclear cells from individuals with clinically-isolated syndrome and different stages of multiple sclerosis.
24535227 2014 Integrative genomic analyses of the histamine H1 receptor and its role in cancer prediction.
24236486 2013 Variability in histamine receptor genes HRH1, HRH2 and HRH4 in patients with hypersensitivity to NSAIDs.
23962049 2014 Histamine stimulates hydrogen peroxide production by bronchial epithelial cells via histamine H1 receptor and dual oxidase.
More...