Property Summary

NCBI Gene PubMed Count 1,912
PubMed Score 12041.64
PubTator Score 7000.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Colitis 46
Coronary artery disease 240
Atherosclerosis 275
Endometriosis 535
diabetes mellitus 1663
Obesity 616
Adenocarcinoma 115
Adenocarcinoma Of Esophagus 14
Adenomatous Polyposis Coli 10
Adrenal Gland Neoplasms 11
Adverse reaction to drug 54
Albuminuria 20
Amyotrophic Lateral Sclerosis 432
Aortic Aneurysm, Abdominal 10
Asphyxia neonatorum 9
Asthma, Aspirin-Induced 13
Autistic Disorder 320
B-Cell Lymphomas 5
Barrett Esophagus 20
Bladder Neoplasm 109
Bladder neck obstruction 4
Bone neoplasms 7
Brain Ischemia 87
Cachexia 10
Carcinoma, Transitional Cell 31
Cardiac arrhythmia 26
Cardiomyopathies 90
Cardiovascular Diseases 50
Cerebrovascular accident 44
Cholangiocarcinoma 32
Cognition Disorders 23
Colonic Neoplasms 126
Colorectal Neoplasms 217
Depressive disorder 48
Dermatologic disorders 65
Diabetes Mellitus, Experimental 106
Drug-Induced Liver Injury 118
Duodenal ulcer 20
Edema 38
Esophageal Neoplasms 67
Fibrosis 40
Gastric ulcer 34
Gastroesophageal reflux disease 37
Glaucoma, Open-Angle 4
Glioma 66
Heart failure 80
Hydronephrosis 19
Hyperalgesia 71
Hyperemia 13
Hyperglycemia 120
Hyperplasia 26
Hypertensive disease 193
Inflammation 109
Inflammatory Bowel Diseases 87
Intestinal Polyps 5
Invasive Ductal Breast Carcinoma 9
Kidney Diseases 86
Kidney Failure, Chronic 45
Kidney Neoplasm 27
Leiomyosarcoma 19
Leukoplakia, Oral 1
Liver Cirrhosis, Experimental 108
Liver carcinoma 217
Lung Neoplasms 171
Lung diseases 48
Lupus Erythematosus, Systemic 73
Mammary Neoplasms 410
Melanoma 261
Mouth Diseases 12
Mouth Neoplasms 44
Neoplasm Metastasis 138
Neoplasm Recurrence, Local 23
Neurogenic Inflammation 12
Oral Submucous Fibrosis 18
Pancreatic Neoplasm 79
Pancreatitis 97
Papilloma 27
Pericardial effusion 10
Precancerous Conditions 69
Precocious puberty 4
Premature Birth 9
Prostatic Neoplasms 471
Proteinuria 63
Renal Cell Carcinoma 199
Reperfusion Injury 84
Seizures 95
Skin Neoplasms 49
Squamous cell carcinoma 96
Squamous cell carcinoma of esophagus 82
Squamous cell carcinoma of the head and neck 24
Status Epilepticus 85
Stomach Neoplasms 282
Thrombosis 42
Thyroid Neoplasm 33
Thyroid associated opthalmopathies 2
Tongue Neoplasms 8
chronic lymphocytic leukemia 244
nervous system disorder 53
Disease Target Count P-value
Breast cancer 3099 1.58050831667527E-26
lung carcinoma 2844 7.20851084830115E-21
breast carcinoma 1614 8.45792265366163E-13
malignant mesothelioma 3163 3.12277264174923E-10
astrocytoma 1493 1.56524897035144E-7
non-small cell lung cancer 2798 1.71655552467094E-7
cystic fibrosis 1670 2.34461753880369E-6
tuberculosis 1563 5.94351735880111E-5
nasopharyngeal carcinoma 1056 6.40881947562251E-5
atypical teratoid / rhabdoid tumor 4369 7.58908050077157E-5
adrenocortical adenoma 134 1.82859307097028E-4
lung cancer 4473 2.81801072625893E-4
medulloblastoma 1524 2.8840821928936E-4
psoriasis 6685 3.51626642882951E-4
pancreatic cancer 2300 9.35989430784158E-4
glioblastoma 5572 9.89243686427446E-4
primitive neuroectodermal tumor 3031 0.00110657809466145
lung adenocarcinoma 2714 0.00551969211802994
adrenocortical carcinoma 1427 0.00563112494966346
interstitial cystitis 2299 0.00674718377827444
medulloblastoma, large-cell 6234 0.00791053064589367
acute myeloid leukemia 785 0.00831068646712234
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0113805241344326
posterior fossa group B ependymoma 1530 0.0155088631488462
aldosterone-producing adenoma 664 0.0177741278045442
ovarian cancer 8492 0.0185332983591097
pediatric high grade glioma 2712 0.0191268918447548
Hydrolethalus syndrome 128 0.0206721098175306
oligodendroglioma 2849 0.0387188078679604
Bipolar Disorder 266 0.0393243421827809
remitted schizophrenia patient 3 0.0450652708602101
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

  Differential Expression (32)

Disease log2 FC p
malignant mesothelioma -7.800 0.000
remitted schizophrenia patient 1.100 0.045
oligodendroglioma -2.100 0.039
astrocytoma -1.400 0.000
glioblastoma -3.100 0.001
medulloblastoma -3.200 0.000
cystic fibrosis 3.051 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -3.600 0.008
primitive neuroectodermal tumor -3.700 0.001
adrenocortical adenoma -1.952 0.000
adrenocortical carcinoma -1.943 0.006
tuberculosis -2.600 0.000
non-small cell lung cancer -1.830 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.011
Hydrolethalus syndrome 2.229 0.021
lung cancer -1.800 0.000
pancreatic cancer 1.900 0.001
interstitial cystitis 2.800 0.007
pediatric high grade glioma -2.100 0.019
posterior fossa group B ependymoma -1.800 0.016
aldosterone-producing adenoma -1.469 0.018
nasopharyngeal carcinoma 3.100 0.000
lung adenocarcinoma -1.841 0.006
psoriasis -1.300 0.000
Breast cancer -3.000 0.000
lung carcinoma -3.400 0.000
breast carcinoma -1.600 0.000
Bipolar Disorder 2.371 0.039
acute myeloid leukemia 2.800 0.008
ulcerative colitis 5.200 0.000
ovarian cancer 1.800 0.019

Synonym

Accession P35354 A8K802 Q16876
Symbols COX2
COX-2
PHS-2
PGG/HS
PGHS-2
hCox-2
GRIPGHS

Gene

PANTHER Protein Class (2)

PDB

1V0X   5F19   5F1A   5IKQ   5IKR   5IKT   5IKV  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2018)

PMID Text
27097228 G6PD deficiency affects the cellular inflammatory response and the decreased TNF-alpha-mediated antiviral response in G6PD-kd A549 cells is a result of dysregulated NOX/MAPK/NF-kappaB/COX-2 signaling
27079437 these results suggest that targeting the COX-2/PGE2 pathway together with TLR/MyD88 signaling, which would suppress the inflammatory microenvironment and maintenance of stemness, could be an effective preventive or therapeutic strategy for gastric cancer
26994820 The results provide evidence that S1P induces COX-2 expression and PGE2 production in human granulosa cells through a S1P1/3-mediated YAP signaling pathway.
26881519 High COX-2 expression was associated with hepatocellular carcinoma.
26859324 Determined are the crystal structures of S530T murine (mu) COX-2, aspirin-acetylated human (hu) COX-2, and huCOX-2 in complex with salicylate to 1.9, 2.0, and 2.4 A, respectively.
26822858 Glucose-related hyperosmolarity seems to be able to promote angiogenesis and retinopathy through activation of TonEBP and possibly increasing expression of AQP1 and COX-2.
26791786 A positive association between the expressions of COX2 and p53 in human breast cancer.
26788504 NFKB1 -94 ins/del and COX-2 (-1195G>A) polymorphisms may be, respectively, associated with decreased and increased prostate cancer risk in the Chinese population.
26744410 Decreased capacity of fibrotic lung fibroblasts to up-regulate COX-2 expression and COX-2-derived PGE2 synthesis is due to an indirect epigenetic mechanism involving hypermethylation of the transcriptional regulator, c8orf4.
26743292 MMP-9 and Cox-2 can be used in clinical practice for the detection of patients with chronic periodontitis risk.
More...

AA Sequence

MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPT      1 - 70
PNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPP     71 - 140
VPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGL    141 - 210
GHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGL    211 - 280
VPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE    281 - 350
LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV    351 - 420
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELY    421 - 490
PALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKG    491 - 560
CPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL                              561 - 604
//

Text Mined References (1915)

PMID Year Title
27097228 2016 Diminished COX-2/PGE2-Mediated Antiviral Response Due to Impaired NOX/MAPK Signaling in G6PD-Knockdown Lung Epithelial Cells.
27079437 2016 Inflammation in gastric cancer: Interplay of the COX-2/prostaglandin E2 and Toll-like receptor/MyD88 pathways.
26994820 2016 Sphingosine-1-phosphate induces COX-2 expression and PGE2 production in human granulosa cells through a S1P1/3-mediated YAP signaling.
26881519 Cyclooxygenase-2 expression is associated with elevated aspartate aminotransferase level in hepatocellular carcinoma.
26859324 2016 Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
26822858 2016 High glucose-induced hyperosmolarity contributes to COX-2 expression and angiogenesis: implications for diabetic retinopathy.
26791786 2016 Cyclooxygenase-2 (COX2) and p53 protein expression are interdependent in breast cancer but not associated with clinico-pathological surrogate subtypes, tumor aggressiveness and patient survival.
26788504 2015 Genetic Variations in Inflammatory Response Genes and Their Association with the Risk of Prostate Cancer.
26744410 2016 Epigenetic regulation of cyclooxygenase-2 by methylation of c8orf4 in pulmonary fibrosis.
26743292 2015 Cyclooxygenase-2 and matrix metalloproteinase-9 expressions correlate with tissue inflammation degree in periodontal disease.
More...