Property Summary

Ligand Count 1,592
NCBI Gene PubMed Count 1,999
PubMed Score 12504.51
PubTator Score 7000.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Colitis 54 4.913 2.5
Coronary artery disease 268 4.318 2.2
Hypertension 396 4.274 2.1
Atherosclerosis 291 4.144 2.1
Endometriosis 540 3.984 2.0
diabetes mellitus 1728 3.818 1.9
Obesity 678 3.162 1.6
Adenocarcinoma 122 0.0 0.0
Adenocarcinoma Of Esophagus 14 0.0 0.0
Adenomatous Polyposis Coli 16 0.0 0.0
Adrenal Gland Neoplasms 11 0.0 0.0
Albuminuria 21 0.0 0.0
Amyotrophic lateral sclerosis 451 0.0 0.0
Aortic Aneurysm, Abdominal 9 0.0 0.0
Arrhythmias, Cardiac 19 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Asthma, Aspirin-Induced 13 0.0 0.0
Asthma, Occupational 10 0.0 0.0
Autistic Disorder 364 0.0 0.0
Barrett Esophagus 16 0.0 0.0
Bone neoplasms 8 0.0 0.0
Brain Injuries 65 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Burns 9 0.0 0.0
Cachexia 50 0.0 0.0
Carcinoma 11493 0.0 1.0
Carcinoma in Situ 1 0.0 0.0
Carcinoma, Ductal, Breast 11 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Carcinoma, squamous cell of head and neck 31 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholangiocarcinoma 35 0.0 0.0
Cognition Disorders 32 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Depressive disorder 409 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 62 0.0 0.0
Duodenal ulcer 20 0.0 0.0
Edema 81 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Esophageal Squamous Cell Carcinoma 77 0.0 0.0
Fibrosis 44 0.0 0.0
Gastroesophageal Reflux 4 0.0 0.0
Glaucoma, Open-Angle 11 0.0 0.0
Glioma 74 0.0 0.0
Graves Ophthalmopathy 2 0.0 0.0
Heart failure 162 0.0 0.0
Hydronephrosis 89 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hyperemia 13 0.0 0.0
Hyperglycemia 137 0.0 0.0
Hyperplasia 27 0.0 0.0
Inflammation 120 0.0 0.0
Inflammatory Bowel Diseases 35 0.0 0.0
Intestinal Polyps 5 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Kidney Neoplasms 37 0.0 0.0
Leiomyosarcoma 24 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Leukoplakia, Oral 20 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Lung diseases 50 0.0 0.0
Lupus Erythematosus, Systemic 67 0.0 0.0
Lymphoma, B-Cell 6 0.0 0.0
Melanoma 711 0.0 0.0
Mouth Diseases 12 0.0 0.0
Mouth Neoplasms 55 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Neoplasms 63 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Neurogenic Inflammation 12 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Pancreatitis 123 0.0 0.0
Papilloma 44 0.0 0.0
Pericardial effusion 14 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Premature Birth 77 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Proteinuria 144 0.0 0.0
Puberty, Precocious 5 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Seizures 596 0.0 0.0
Skin Diseases 71 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Stroke 33 0.0 0.0
Thrombosis 46 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Tongue Neoplasms 8 0.0 0.0
Urinary Bladder Neck Obstruction 1 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.4

Expression

  Differential Expression (32)

Disease log2 FC p
acute myeloid leukemia 1.800 3.9e-02
adrenocortical adenoma -1.952 1.8e-04
adrenocortical carcinoma -1.943 5.6e-03
aldosterone-producing adenoma -1.469 1.8e-02
astrocytoma -1.400 1.6e-07
atypical teratoid / rhabdoid tumor -1.800 4.8e-04
Bipolar Disorder 2.371 3.9e-02
Breast cancer -3.000 1.6e-26
breast carcinoma -1.600 8.5e-13
cystic fibrosis 1.477 6.1e-05
glioblastoma -1.100 4.2e-02
Hydrolethalus syndrome 2.229 2.1e-02
interstitial cystitis 2.700 1.6e-02
intraductal papillary-mucinous adenoma (... -1.600 1.1e-02
lung adenocarcinoma -1.841 5.5e-03
lung cancer -1.800 2.8e-04
lung carcinoma -3.400 7.2e-21
malignant mesothelioma -7.800 3.1e-10
medulloblastoma -1.800 2.3e-03
medulloblastoma, large-cell -2.100 2.6e-02
nasopharyngeal carcinoma 2.300 7.7e-04
non-small cell lung cancer -1.775 4.5e-07
oligodendroglioma -2.100 3.9e-02
ovarian cancer 1.800 1.9e-02
pancreatic cancer 1.600 1.4e-03
pediatric high grade glioma -1.500 3.0e-02
posterior fossa group B ependymoma -1.500 2.4e-03
primitive neuroectodermal tumor -2.200 3.7e-03
psoriasis -1.100 2.7e-02
remitted schizophrenia patient 1.100 4.5e-02
tuberculosis -2.500 1.8e-04
ulcerative colitis 3.900 1.1e-04

 GWAS Trait (1)

Gene RIF (2106)

AA Sequence

MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPT      1 - 70
PNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPP     71 - 140
VPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGL    141 - 210
GHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGL    211 - 280
VPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE    281 - 350
LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV    351 - 420
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELY    421 - 490
PALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKG    491 - 560
CPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL                              561 - 604
//

Text Mined References (2002)

PMID Year Title