Property Summary

NCBI Gene PubMed Count 111
Grant Count 41
R01 Count 20
Funding $4,882,907.23
PubMed Score 150.42
PubTator Score 199.68

Knowledge Summary

Patent (4,961)

TINX Plot

  Disease Relevance (69)

Disease Z-score Confidence
Ureterolithiasis 4 4.35 2.2
Ureter carcinoma 2 3.578 1.8
Schizophrenia 501 3.388 1.7
Attention deficit hyperactivity disorder 156 3.241 1.6
Acute exacerbation of asthma 14
Administration of Local Anesthetic Nerve... 14 
Allergic Reactions 7
Allergic conjunctivitis 25
Allergic rhinitis 91
Asthma 349
Asthma management 20
Benign prostatic hyperplasia 7
Bronchiectasis 29
Bronchitis 44
Cerebral ischemia 12
Cerebrovascular disease 231
Common cold 63
Cough 21
Dermal Necrosis 6
Diabetes Mellitus, Experimental 106
Diagnostic Test for Pheochromocytoma 6
Dilated pupil 6
Disorder of blood vessel 4
Dyspnea 8
Essential Hypertension 82
Exacerbation of asthma 11
Fever 34
Headache disorder 20
Hemorrhoids 13
Hypertension Secondary to Pheochromocyto... 6 
Hypertensive Emergencies 10
Hypertensive disorder 58
Hypertensive emergency 3
Hypotension Secondary to Spinal Anesthes... 2 
Influenza-like symptoms 17
Liver Cirrhosis 101
Local anesthesia 40
Local anesthesia, by infiltration 14
Low blood pressure 9
Nasal congestion 24
Nasal discharge 26
Open-angle glaucoma 26
Orthostatic hypotension 9
Parkinson's disease 364
Paroxysmal hypertension 6
Paroxysmal supraventricular tachycardia 11
Peripheral vascular disease 90
Persistent erythema of skin 2
Persistent pulmonary hypertension of the... 8 
Pheochromocytoma 22
Prevention of Hypertension in Pheochromo... 6 
Prevention of Hypotension During Spinal ... 2 
Prevention of Posterior Synechiae 4
Proctitis 11
Pruritus ani 14
Pulmonary emphysema 34
Rectal pain 3
Red eye 7
Reverse Mydriasis from Ophthalmic Adrene... 2 
Rhinitis 46
Seasonal allergic rhinitis 10
Sinus headache 17
Sneezing 11
Vasomotor rhinitis 15
Ventricular Remodeling 5
Wheezing 7
anaphylaxis 11
lung cancer 4,466
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.200 0.023
psoriasis -2.100 0.000

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2

Gene RIF (92)

PMID Text
25913761 alpha1A-adrenoceptor subtypes predominantly contributed to human IAS contraction
25775528 heteromeric receptor complexes between alpha1A-AR and CXCR4 and between alpha1B-AR and CXCR4 are constitutively expressed in rat and human vascular smooth muscle cells; the quaternary structure of the receptor complex is important for signaling and contraction
25606852 Data are presented that indicate that Iso represents a novel type of alpha1A-AR partial agonist with signaling bias toward MAPK/ERK signaling cascade that is likely independent of coupling to Galphaq.
25425303 The alpha-AR-induced mydriasis in mice is mediated mainly by the alphaA-AR, with a smaller contribution of the alphaB-AR, matching the relative abundance of these subtypes at the mRNA level.
24844469 alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts.
24835978 The ADRA1A mutant triggers two distinct EGFR transactivation-dependent signaling pathways: 1) constitutive Gq-independent beta-arrestin-1/Src/MMP/EGFR/ERK-dependent hyperproliferation and 2) agonist-induced Gq- and EGFR/STAT-dependent hypertrophy.
24548768 Data suggested ADRA1A Arg347Cys polymorphism as susceptibility factor in patients with vasovagal syncope; ArgArg genotype could be a marker for vasovagal syncope susceptibility in the Mexican population
24342464 alpha1-AR expression is greater on nerve fibers in skin affected by complex regional pain syndrome type II (CRPS) than in unaffected skin from the same patient or from pain-free controls.
23902938 Adrenergic alpha1A receptor subtypes transactivate epidermal growth factor receptors.
23877383 Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively.
More...

AA Sequence

MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAV      1 - 70
ADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQ     71 - 140
RRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVV    141 - 210
AKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGC    211 - 280
FVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQ    281 - 350
SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT    351 - 420
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV                            421 - 466
//

Text Mined References (116)

PMID Year Title
25913761 2015 Characterizations of the ?1-adrenoceptor subtypes mediating contractions of the human internal anal sphincter.
25775528 2015 Heteromerization of chemokine (C-X-C motif) receptor 4 with ?1A/B-adrenergic receptors controls ?1-adrenergic receptor function.
25606852 2015 Isoproterenol acts as a biased agonist of the alpha-1A-adrenoceptor that selectively activates the MAPK/ERK pathway.
25425303 2014 Role of ??-adrenoceptor subtypes in pupil dilation studied with gene-targeted mice.
24844469 2014 The stimulatory effects of alpha1-adrenergic receptors on TGF-beta1, IGF-1 and hyaluronan production in human skin fibroblasts.
24835978 2014 Alpha1a-adrenoceptor genetic variant induces cardiomyoblast-to-fibroblast-like cell transition via distinct signaling pathways.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24548768 2014 Arg347Cys polymorphism of ?1a-adrenergic receptor in vasovagal syncope. Case-control study in a Mexican population.
24342464 2014 Upregulation of ?1-adrenoceptors on cutaneous nerve fibres after partial sciatic nerve ligation and in complex regional pain syndrome type II.
23902938 2013 Intracellular transactivation of epidermal growth factor receptor by ?1A-adrenoceptor is mediated by phosphatidylinositol 3-kinase independently of activation of extracellular signal regulated kinases 1/2 and serine-threonine kinases in Chinese hamster ovary cells.
More...