Property Summary

Ligand Count 1,063
NCBI Gene PubMed Count 116
PubMed Score 155.51
PubTator Score 199.68

Knowledge Summary

Patent (4,961)

TINX Plot

  Disease (7)

Disease Target Count
Acute exacerbation of asthma 14
Administration of Local Anesthetic Nerve Block 14
Allergic Reactions 7
Allergic conjunctivitis 22
Allergic rhinitis 94
Asthma 385
Asthma management 19
Benign prostatic hyperplasia 7
Bronchiectasis 64
Bronchitis 43
Cerebral Ischemia 37
Cerebrovascular disease 238
Common cold 67
Cough 23
Dermal Necrosis 6
Diagnostic Test for Pheochromocytoma 6
Dilated pupil 6
Disorder of blood vessel 4
Dyspnea 76
Essential Hypertension 94
Exacerbation of asthma 11
Fever 138
Headache disorder 19
Hemorrhoids 13
Hypertension Secondary to Pheochromocytoma 6
Hypertensive Emergencies 10
Hypertensive disorder 56
Hypertensive emergency 3
Hypotension Secondary to Spinal Anesthesia 2
Influenza-like symptoms 16
Local anesthesia 40
Local anesthesia, by infiltration 14
Low blood pressure 9
Nasal congestion 21
Nasal discharge 24
Open-angle glaucoma 27
Orthostatic hypotension 9
Parkinson's disease 392
Paroxysmal hypertension 6
Paroxysmal supraventricular tachycardia 12
Peripheral vascular disease 87
Persistent erythema of skin 2
Persistent pulmonary hypertension of the newborn 8
Pheochromocytoma 24
Prevention of Hypertension in Pheochromocytoma 6
Prevention of Hypotension During Spinal Anesthesia 2
Prevention of Posterior Synechiae 4
Proctitis 13
Pruritus ani 14
Pulmonary emphysema 48
Rectal pain 3
Red eye 7
Reverse Mydriasis from Ophthalmic Adrenergic or Anticholinergic Agent 2
Rhinitis 54
Seasonal allergic rhinitis 9
Sinus headache 16
Sneezing 12
Vasomotor rhinitis 12
Wheezing 7
anaphylaxis 11
Disease Target Count P-value
psoriasis 6694 9.7e-68
lung cancer 4740 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.200 2.3e-02
psoriasis -2.100 9.7e-68

Gene RIF (96)

AA Sequence

MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAV      1 - 70
ADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQ     71 - 140
RRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVV    141 - 210
AKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGC    211 - 280
FVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQ    281 - 350
SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT    351 - 420
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV                            421 - 466
//

Text Mined References (121)

PMID Year Title