Property Summary

NCBI Gene PubMed Count 92
Grant Count 19
R01 Count 11
Funding $832,249.03
PubMed Score 116.16
PubTator Score 179.29

Knowledge Summary

Patent (12,063)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.001

Gene RIF (73)

PMID Text
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
25925002 SSTR2 and SSTR5 protein levels were induced as compared to any agent alone.
25854304 This is the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior, suggesting that sst5TMD4 might play a functionally relevant role.
25808161 Data indicate that somatostatin receptor scintigraphy (SRS) and immunohistochemical results for somatostatin and dopamine receptors sstr2, sstr3, sstr5 and D2R were compared in neuroendocrine neoplasms tissues.
25765179 Somatostatin receptors were expressed in a high proportion of merkel cell carcinomas, although expression was heterogeneous between tumours and was not associated with disease severity.
25637790 A truncated sst5-variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analogues-therapy.
25008035 SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume.
24967740 SSTR 5 was shown to be the main receptor subtype in the analysed differentiated or anaplastic thyroid malignancies, whereas SSTR 2 was found only in a small percentage.
24634938 Tumor cells in the tissue samples of the patients diagnosed with advanced-stage hepatocellular carcinoma expressed a high proportion of SSTR1 and SSTR5.
More...

AA Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAK      1 - 70
MKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLA     71 - 140
VVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGF    141 - 210
FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEP    211 - 280
ASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA    281 - 350
HRAAANGLMQTSKL                                                            351 - 364
//

Text Mined References (93)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
25925002 2015 Docetaxel in combination with octreotide shows synergistic apoptotic effect by increasing SSTR2 and SSTR5 expression levels in prostate and breast cancer cell lines.
25854304 2015 The expression of the truncated isoform of somatostatin receptor subtype 5 associates with aggressiveness in medullary thyroid carcinoma cells.
25808161 2015 Somatostatin and dopamine receptor expression in neuroendocrine neoplasms: correlation of immunohistochemical findings with somatostatin receptor scintigraphy visual scores.
25765179 2015 Somatostatin Receptors 2A and 5 Are Expressed in Merkel Cell Carcinoma with No Association with Disease Severity.
25637790 2015 Truncated somatostatin receptor variant sst5TMD4 confers aggressive features (proliferation, invasion and reduced octreotide response) to somatotropinomas.
25008035 2014 Cytoplasmic expression of SSTR2 and 5 by immunohistochemistry and by RT/PCR is not associated with the pharmacological response to octreotide.
24967740 2014 Expression of somatostatin receptor subtype 2 and subtype 5 in thyroid malignancies.
24634938 2013 Somatostatin receptor 1 (SSTR1) and somatostatin receptor 5 (SSTR5)expression in hepatocellular carcinoma.
More...