Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
R01 Count 4
Funding $522,310
PubMed Score 8.87
PubTator Score 491.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.002
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer 4.165 0.000
lung cancer -4.800 0.007
cystic fibrosis 3.200 0.000
psoriasis 6.900 0.000
nasopharyngeal carcinoma -1.900 0.003
head and neck cancer 2.000 0.027

Gene RIF (5)

PMID Text
24123265 SPRR2a modulates ZEB-1 signaling by way of miR-200c/141-associated epithelial mesenchyme transition through SH3-domain networks and contributes to benign and malignant wound-healing responses.
23728799 SPRR2A-associated tumor behavior was mimicked by MUC1 shRNA, which induced EMT and, like SPRR2A+ cells, showed reduced metastatic capabilities
22731250 SPRR2A functions as a suppressor of p53-dependent transcriptional activity, which otherwise might impede cellular processes needed for epithelial wound repair responses.
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18155796 Small proline-rich proteins (SPRR2A) function as SH3 domain ligands, increase resistance to injury and are associated with epithelial-mesenchymal transition (EMT) in cholangiocytes.

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (18)

PMID Year Title
24123265 2014 Small proline rich protein 2a in benign and malignant liver disease.
23728799 2013 SPRR2A expression in cholangiocarcinoma increases local tumor invasiveness but prevents metastasis.
22731250 2012 SPRR2A enhances p53 deacetylation through HDAC1 and down regulates p21 promoter activity.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18155796 2008 Small proline-rich proteins (SPRR) function as SH3 domain ligands, increase resistance to injury and are associated with epithelial-mesenchymal transition (EMT) in cholangiocytes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16639001 2006 Expression and regulation of cornified envelope proteins in human corneal epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...