Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.78
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Asthma 385 0.0 0.0
Disease Target Count P-value
psoriasis 6694 0.0e+00

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 7.500 0.0e+00

Gene RIF (4)

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (11)

PMID Year Title