1. Home
  2. Targets
  3. Small proline-rich protein 2B

Tdark Small proline-rich protein 2B

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.78
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Asthma 349
Disease Target Count P-value
psoriasis 6685 0.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 7.500 0.000

Synonym

Accession P35325 Q5T528 SPR-2B
Symbols

Gene

SPRR2B

 GO Function (1)

 GO Component (2)

 GO Process (4)

 Compartment GO Term (10)

 HCA RNA Cell Line (7)

Pathway (3)

 UniProt Keyword (6)

Gene RIF (4)

PMID Text
22374195 An SNP in SPRR2B was predictive of asthma among white children with eczema from 2 independent populations.
21985131 We showed that just four genes, G3BP2, SCARB2, CSNK1A1 and SPRR2B, can classify patients as presence of lymph node metastasis negative or positive, with 80.0% accuracy.
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
14748073 SPR2B transcripts and protein were moderately increased in the human papillomaviurs 11- and 59-infected tissues.

AA Sequence 

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (11)

PMID Year Title
22374195 2012 Genetic variation in small proline rich protein 2B as a predictor for asthma among children with eczema.
21985131 2012 Four-gene expression model predictive of lymph node metastases in oral squamous cell carcinoma.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16639001 2006 Expression and regulation of cornified envelope proteins in human corneal epithelium.
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
14748073 2004 Infection with Human Papillomavirus alters expression of the small proline rich proteins 2 and 3.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
9722562 1998 Structural and transglutaminase substrate properties of the small proline-rich 2 family of cornified cell envelope proteins.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.
More...