Property Summary

NCBI Gene PubMed Count 18
Grant Count 13
R01 Count 10
Funding $504,682.92
PubMed Score 13.42
PubTator Score 17.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -4.800 0.025
psoriasis 3.400 0.000
cutaneous lupus erythematosus 2.900 0.000
non-small cell lung cancer 4.773 0.000
intraductal papillary-mucinous neoplasm ... 5.500 0.007
pancreatic cancer 2.200 0.023
lung cancer -5.400 0.007
diabetes mellitus 1.600 0.002
cystic fibrosis 3.600 0.000
nasopharyngeal carcinoma -3.400 0.000
head and neck cancer 1.900 0.047

Gene RIF (5)

PMID Text
25424702 the SPRR1A status might play an important role in the prognosis of postmenopausal breast carcinoma patients, especially that of progesterone receptor-positive subgroups.
24886019 A expression may be useful as a prognostic factor for diffuse large B-cell lymphoma.
19672094 the deregulated increase in SPRR1A expression in chronic atopic skin lesions reflects an insufficient rise in SPRR transcripts, unable to compensate for the lack of LOR and thus contributing to the persistence of chronic atopic dermatitis skin lesions.
19601998 Observational study of gene-disease association. (HuGE Navigator)
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence

MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVP      1 - 70
EPCPSTVTPAPAQQKTKQK                                                        71 - 89
//

Text Mined References (19)

PMID Year Title
25424702 2015 Clinical significance of SPRR1A expression in progesterone receptor-positive breast cancer.
24886019 2014 Clinical implications of SPRR1A expression in diffuse large B-cell lymphomas: a prospective, observational study.
19672094 2010 Locus 1q21 Gene expression changes in atopic dermatitis skin lesions: deregulation of small proline-rich region 1A.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850458 2002 Small proline-rich repeat protein 1A is expressed by axotomized neurons and promotes axonal outgrowth.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
More...