Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.10
PubTator Score 17.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 2.900 7.1e-05
cystic fibrosis 3.600 1.1e-04
diabetes mellitus 1.600 1.8e-03
esophageal adenocarcinoma -4.800 2.5e-02
head and neck cancer 1.900 4.7e-02
intraductal papillary-mucinous neoplasm ... 5.500 6.5e-03
lung cancer -5.400 6.9e-03
nasopharyngeal carcinoma -3.400 2.9e-04
non-small cell lung cancer 4.773 1.8e-10
pancreatic cancer 2.200 2.3e-02
psoriasis 2.400 1.2e-04

Gene RIF (6)

AA Sequence

MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVP      1 - 70
EPCPSTVTPAPAQQKTKQK                                                        71 - 89
//

Text Mined References (21)

PMID Year Title