Property Summary

NCBI Gene PubMed Count 325
PubMed Score 1888.97
PubTator Score 1077.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 2.344 4.2e-02
active ulcerative colitis 3.264 3.3e-03
acute quadriplegic myopathy 1.249 1.2e-06
atypical teratoid / rhabdoid tumor 1.500 9.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.211 2.6e-03
breast carcinoma -3.100 9.9e-06
dermatomyositis 2.400 4.7e-04
ductal carcinoma in situ -1.900 1.8e-03
fibroadenoma -3.300 1.8e-03
gastric cancer -2.000 2.0e-03
glioblastoma 1.900 2.8e-04
group 4 medulloblastoma -1.200 3.6e-02
hepatocellular carcinoma -1.500 1.1e-03
interstitial cystitis 1.200 1.5e-02
intraductal papillary-mucinous adenoma (... -1.800 3.6e-03
intraductal papillary-mucinous neoplasm ... 2.200 8.7e-03
invasive ductal carcinoma -1.900 1.1e-02
juvenile dermatomyositis 1.052 1.0e-06
lung cancer -1.100 8.4e-04
medulloblastoma, large-cell -1.300 3.7e-02
Multiple myeloma 2.656 4.3e-03
Multiple Sclerosis 1.400 3.8e-03
pancreatic cancer 1.600 8.8e-04
pediatric high grade glioma 1.500 1.3e-02
pituitary cancer -2.800 8.5e-06
posterior fossa group A ependymoma 1.800 1.4e-04
psoriasis -2.000 4.9e-07
Rheumatoid arthritis 2.100 2.8e-02
tuberculosis -1.900 4.5e-03

Gene RIF (282)

AA Sequence

MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRP      1 - 70
QDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSK     71 - 140
ISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL                             141 - 185
//

Text Mined References (327)

PMID Year Title