Property Summary

NCBI Gene PubMed Count 306
Grant Count 285
R01 Count 147
Funding $44,149,219.68
PubMed Score 1832.47
PubTator Score 1077.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35318 B2R793 D3DQV3 Q6FGW2
Symbols AM
PAMP

Gene

ADM

PANTHER Protein Class (2)

PDB

2FLY   2L7S   4RWF  

 GO Function (1)

Gene RIF (265)

PMID Text
26762744 High Adrenomedullin expression is associated with Malignant Pleural Mesothelioma.
26662217 conclusion supplementation with selenium and coenzyme Q10 during four years resulted in less concentration of both copeptin and MR-proADM
26597206 In addition to its role in the complement system, complement factor H has an another role, as a binding protein for the regulatory peptide adrenomedullin. (Review)
26461449 Higher levels of Proadrenomedullin are associated with Primary Graft Dysfunction and Mortality Following Lung Transplantation.
26342564 we found significantly lower plasma MR-proADM levels in patients with elevated anxiety scores
26286191 Proadrenomedullin was increased in complicated vs. uncomplicated community acquired pediatric pneumonia.
26271020 Among adrenomedullin, CRP, and PCT, procalcitonin demonstrates the highest correlation with the severity of infection.
26196743 tested the hypothesis that AM-deficient fetal primary pulmonary microvascular endothelial cells (HPMEC) will have increased oxidative stress, inflammation, and cytotoxicity compared to AM-sufficient HPMEC upon exposure to hyperoxia
26043778 Results suggest that ADM plays an important role in intrahepatic cholangiocellular carcinoma metastasis, and that ADM signaling of epithelial-mesenchymal transition may represent a valuable therapeutic target in cancer patients.
26035796 targeting of the ADM/ADM acceptors/ERK1/2/Bcl-2 pathway may provide a potential strategy through which to induce the apoptosis of osteosarcoma cells.
More...

AA Sequence

MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRP      1 - 70
QDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSK     71 - 140
ISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL                             141 - 185
//

Text Mined References (308)

PMID Year Title
26762744 2016 Functional Analysis of the Adrenomedullin Pathway in Malignant Pleural Mesothelioma.
26662217 Less increase of copeptin and MR-proADM due to intervention with selenium and coenzyme Q10 combined: Results from a 4-year prospective randomized double-blind placebo-controlled trial among elderly Swedish citizens.
26597206 2015 Complement factor H in its alternative identity as adrenomedullin-binding protein 1.
26461449 2016 Primary Graft Dysfunction and Mortality Following Lung Transplantation: A Role for Proadrenomedullin Plasma Levels.
26342564 2015 Plasma mid-regional pro-adrenomedullin levels are inversely associated with anxiety but unrelated to depression: Results from the observational DIAST-CHF study in patients with cardiovascular risk factors.
26286191 2015 Proadrenomedullin and copeptin in pediatric pneumonia: a prospective diagnostic accuracy study.
26271020 2015 Adrenomedullin--A New Marker in Febrile Neutropenia: Comparison With CRP and Procalcitonin.
26196743 2015 Adrenomedullin deficiency potentiates hyperoxic injury in fetal human pulmonary microvascular endothelial cells.
26043778 2015 Adrenomedullin promotes intrahepatic cholangiocellular carcinoma metastasis and invasion by inducing epithelial-mesenchymal transition.
26035796 2015 Hypoxia-induced apoptosis is blocked by adrenomedullin via upregulation of Bcl-2 in human osteosarcoma cells.
More...