Property Summary

NCBI Gene PubMed Count 72
Grant Count 84
R01 Count 67
Funding $6,313,807.46
PubMed Score 42.79
PubTator Score 64.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mixed connective tissue disease 16 3.148 1.6

Expression

Synonym

Accession P35269 B2RCS0 Q9BWN0
Symbols BTF4
RAP74
TF2F1
TFIIF

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1J2X   1ONV   2K7L   1F3U   1I27   1NHA  

Gene RIF (29)

PMID Text
22343046 These results suggest that Mediator structural shifts induced by activator binding help stably orient pol II prior to transcription initiation within the human mediator-RNA polymerase II-TFIIF assembly.
22244332 Gdown1 competes with TFIIF for binding to the RPB1 and RPB5 subunits of Pol II, thereby inhibiting an essential function of TFIIF in preinitiation complex assembly.
21896726 Data show that TFIIF has an important role in stabilizing TFIIB within the PIC and after transcription initiates.
21489275 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
19215094 NMR and thermodynamic studies further elucidate the complex molecular mechanism by which TFIIF and FCP1 cooperate for RNAPII recycling.
18976975 Knockdown of general transcription factor IIF, polypeptide 1 (GTF2F1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18950845 Observational study of gene-disease association. (HuGE Navigator)
18284209 Mutated hydrophobic residues in RAP74 C-terminal structure disrupt secondary structure elements, showing that binding of the androgen receptor N-terminal domain depends upon helix 3 in the winged-helix domain of the RAP74 C-terminal domain polypeptide.
17848138 TFIIF and Rpb7 are involved in both early and late transcriptional stages
15831464 alpha1-Helix of RAP74 is important for supporting NTP-driven translocation by RNAP II.
More...

AA Sequence

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE      1 - 70
FNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV     71 - 140
HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL    141 - 210
EDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS    211 - 280
SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE    281 - 350
SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA    351 - 420
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV    421 - 490
NVLAQILKRLNPERKMINDKMHFSLKE                                               491 - 517
//

Text Mined References (84)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22343046 2012 Activator-mediator binding stabilizes RNA polymerase II orientation within the human mediator-RNA polymerase II-TFIIF assembly.
22244332 2012 Transcriptional regulation by Pol II(G) involving mediator and competitive interactions of Gdown1 and TFIIF with Pol II.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21896726 2011 Transcription factor TFIIF is not required for initiation by RNA polymerase II, but it is essential to stabilize transcription factor TFIIB in early elongation complexes.
More...