Property Summary

NCBI Gene PubMed Count 37
Grant Count 40
R01 Count 19
Funding $4,201,666.05
PubMed Score 126.65
PubTator Score 94.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25196364 considering the high mutation frequency found, our data point toward an important role for RPL22 in microsatellite instability carcinogenesis
24840952 Study revealved that RPL22 binds CK2alpha in lung cancer cells.
23797773 Down-regulation of RPL22 might be involved in the carcinogenesis of NSCLC.
23127973 RPL22 is frequently mutated in MSI-high endometrioid endometrial cancers. The A8 mutation identified was not reported in the whole exome sequences analyzed by the TCGA.
22976955 Rpl22 inactivation promotes neoplastic transformation by inducing expression of Lin28B
19640998 Growth-promoting properties of Epstein-Barr virus EBER-1 RNA correlate with ribosomal protein L22 binding
16564389 The EBER-ISH as an independent prognostic factor of NPC regardless of histopathology.
16556938 Multiple domains of EBER 1 recruit ribosomal protein L22.
15812220 The EBER in situ hybridization showed negative results despite racial or geographical factors might influence the peculiar susceptibility of individuals of Asian ancestry to Epstein-Barr virus-associated lymphoepithelioma-like carcinoma.

AA Sequence

MAPVKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKI      1 - 70
TVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED                 71 - 128
//

Text Mined References (43)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25196364 2014 High frequency of RPL22 mutations in microsatellite-unstable colorectal and endometrial tumors.
24840952 2014 Interaction of ribosomal protein L22 with casein kinase 2?: a novel mechanism for understanding the biology of non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23797773 2013 Down-regulation of ribosomal protein L22 in non-small cell lung cancer.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...