Property Summary

NCBI Gene PubMed Count 37
PubMed Score 133.47
PubTator Score 94.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.100 2.9e-11
group 3 medulloblastoma 1.100 7.4e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.6e-02
invasive ductal carcinoma -1.104 4.4e-05
lung adenocarcinoma -1.700 1.8e-09
Multiple myeloma 2.092 5.1e-04
ovarian cancer -2.100 1.3e-07
Waldenstrons macroglobulinemia 1.769 1.4e-03

Gene RIF (9)

AA Sequence

MAPVKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKI      1 - 70
TVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED                 71 - 128
//

Text Mined References (44)

PMID Year Title