Property Summary

NCBI Gene PubMed Count 35
PubMed Score 19.70
PubTator Score 12.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
glioblastoma 1.200 0.000
group 3 medulloblastoma 1.400 0.002
non-small cell lung cancer 1.015 0.000
diabetes mellitus -1.200 0.005
pediatric high grade glioma 1.200 0.000

Gene RIF (9)

PMID Text
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18245774 RPA plays a regulatory role in DNA damage responses via repression of RFC2 ubiquitylation in human cells.
16413017 The cAMP functions as an upstream modulator that regulates the expression and nuclear translocation of RFC40 protein.
15655353 evidence is presented for a novel interaction between RFC40 and the RIalpha subunit of PKA; findings indicate that modulation in the formation of the RFC40-RIa complex is associated with decreased cell survival
12036885 Upregulation by BCR/ABL requires activation of STAT5 and plays a key role in the BCR/ABL-mediated cell protection from apoptosis.
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP      1 - 70
NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIIL     71 - 140
DEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKER    141 - 210
VPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYK    211 - 280
ILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMA    281 - 350
PVAS                                                                      351 - 354
//

Text Mined References (41)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
More...