Property Summary

NCBI Gene PubMed Count 201
Grant Count 127
R01 Count 69
Funding $20,297,809.45
PubMed Score 653.04
PubTator Score 533.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P35247 Q5T0M3 Q6FH08 Q86YK9 Q8TCD8 Q9UCJ2 Q9UCJ3 PSP-D
Symbols SP-D
PSP-D
SFTP4
COLEC7

Gene

PANTHER Protein Class (1)

PDB

1B08   1M7L   1PW9   1PWB   2GGU   2GGX   2ORJ   2ORK   2OS9   2RIA   2RIB   2RIC   2RID   2RIE   3DBZ   3G81   3G83   3G84   3IKN   3IKP   3IKQ   3IKR   4E52   4M17   4M18  

 GO Function (1)

Gene RIF (198)

PMID Text
27012038 The SP-D level showed positive correlations with carotid IMT and coronary artery calcification in patients on long-term hemodialysis.
26617840 Serum SP-D may serve as a convenient medium to distinguish lung infection caused by M. pneumoniae.
26603976 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy.
26568332 Quantitative real-time PCR experiments disclosed significantly increased leukocyte NOS2 and SFTPD mRNA levels in hyperglycemic gestational diabetes mellitus patients (P < 0.05).
26424433 Serum SP-D was not significantly different between patients with connective tissue disease-interstitial lung disease, chronic fibrosing interstitial pneumonia patients and healthy controls.
26206179 findings shed new light on the discovery and/or development of a useful biomarker based on glycosylation changes for diagnosing COPD.
25851191 In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function.
25848896 SP-D is expressed differently in airways of asthmatics relative to that of non-asthmatics.
25728058 Sputum and bronchoalveolar lavage fluid SFTPD were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls.
25591150 Letter: report higher serum SP-D levels in bird-related hypersensitivity pneumonitis during winter.
More...

AA Sequence

MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG      1 - 70
AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGE     71 - 140
AGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIP    141 - 210
GDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLL    211 - 280
CTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSED    281 - 350
CVEIFTNGKWNDRACGEKRLVVCEF                                                 351 - 375
//

Text Mined References (203)

PMID Year Title
27012038 2016 Serum Surfactant Protein D is Associated with Atherosclerosis of the Carotid Artery in Patients on Maintenance Hemodialysis.
26617840 2015 SP-D, KL-6, and HTI-56 levels in children with mycoplasma pneumoniae pneumonia.
26603976 2016 Expression and localization of collectins in feto-maternal tissues of human first trimester spontaneous abortion and abortion prone mouse model.
26568332 2016 Increased expression of immune-related genes in leukocytes of patients with diagnosed gestational diabetes mellitus (GDM).
26424433 2015 Serum B cell-activating factor (BAFF) level in connective tissue disease associated interstitial lung disease.
26206179 2015 Fucosylated surfactant protein-D is a biomarker candidate for the development of chronic obstructive pulmonary disease.
25851191 2015 Biomarkers for lung epithelium injury in occupational hexavalent chromium-exposed workers.
25848896 2015 Expression of surfactant protein D in airways of asthmatics and interleukin-13 modulation of surfactant protein D in human models of airway epithelium.
25728058 2015 Sputum and BAL Clara cell secretory protein and surfactant protein D levels in asthma.
25591150 2015 Seasonal variation of serum KL-6 and SP-D levels in bird-related hypersensitivity pneumonitis.
More...