Property Summary

NCBI Gene PubMed Count 217
PubMed Score 698.41
PubTator Score 533.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 4.8e-03
facioscapulohumeral dystrophy 1.800 1.5e-02
intraductal papillary-mucinous carcinoma... -1.100 3.1e-03
lung adenocarcinoma -1.200 1.9e-05
lung cancer -3.700 2.8e-05
lung carcinoma -2.300 1.7e-24
non-small cell lung cancer -4.202 3.8e-17
posterior fossa group B ependymoma 1.400 2.5e-05

Gene RIF (208)

AA Sequence

MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG      1 - 70
AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGE     71 - 140
AGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIP    141 - 210
GDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLL    211 - 280
CTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSED    281 - 350
CVEIFTNGKWNDRACGEKRLVVCEF                                                 351 - 375
//

Text Mined References (219)

PMID Year Title