Property Summary

NCBI Gene PubMed Count 51
PubMed Score 67.07
PubTator Score 40.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.400 1.3e-05
intraductal papillary-mucinous neoplasm ... 1.200 9.7e-04
lung cancer 1.300 2.3e-03
malignant mesothelioma 1.200 9.6e-07
ovarian cancer 1.100 1.4e-03

Gene RIF (13)

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV      1 - 70
GRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD                        71 - 121
//

Text Mined References (62)

PMID Year Title