Property Summary

NCBI Gene PubMed Count 47
Grant Count 6
R01 Count 5
Funding $327,290.33
PubMed Score 59.26
PubTator Score 40.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.001
lung cancer 1.400 0.000
ovarian cancer 1.100 0.001
Breast cancer 1.400 0.000

Synonym

Accession P35244 Q549U6 RP-A p14
Symbols REPA3
RP-A p14

Gene

PDB

1L1O   1QUQ   2PI2   2PQA   2Z6K   3KDF  

Gene RIF (11)

PMID Text
23573956 The allele "T" of rs6947203 in the RPA3 gene acts as a protective allele in glioma.
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19010961 RPA3 interacts directly with ssDNA on the 3'-side on a 31 nt ssDNA.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17494052 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV      1 - 70
GRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD                        71 - 121
//

Text Mined References (57)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23573956 2013 TP53 and RPA3 gene variations were associated with risk of glioma in a Chinese Han population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21269460 2011 Initial characterization of the human central proteome.
More...