Property Summary

NCBI Gene PubMed Count 26
PubMed Score 283.17
PubTator Score 199.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (8)

AA Sequence

MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVF      1 - 70
RSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKL     71 - 140
LPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA              141 - 200
//

Text Mined References (27)

PMID Year Title