Property Summary

NCBI Gene PubMed Count 25
Grant Count 88
R01 Count 69
Funding $10,455,338.56
PubMed Score 275.67
PubTator Score 199.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P35243 Q53XL0
Symbols RCV1

Gene

PDB

2D8N  

Gene RIF (7)

PMID Text
26584024 Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
21344177 C39D substitution reduces alpha-helical content, decreases thermal stability and suppresses membrane association.
20812967 Aberrant hypomethylation of the recoverin gene region, overlapping the promoter up-stream of the first exon and the first exon itself, is involved in the aberrant expression of recoverin in tumor cells.
18266817 A GRK1 region close to its C-terminus also seemed to be the binding site for S-modulin/recoverin.
17374419 Human recoverin is expressed in SCLC cells cultured from an anti-recoverin antibody-negative patient with CAR. KK0206 might be important for further research on SCLC related retinopathy.
12789533 There are cis-acting elements in the 5' non-coding region of the recoverin gene that are involved in the activation and suppression of gene expression.
12596918 recoverin has a pathological role in cancer-associated retinopathy

AA Sequence

MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVF      1 - 70
RSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKL     71 - 140
LPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA              141 - 200
//

Text Mined References (26)

PMID Year Title
26584024 2015 Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21344177 2012 Oxidation mimicking substitution of conservative cysteine in recoverin suppresses its membrane association.
20812967 2010 Aberrant demethylation of the recoverin gene is involved in the aberrant expression of recoverin in cancer cells.
18266817 Amino acid residues in GRK1/GRK7 responsible for interaction with S-modulin/recoverin.
17374419 2007 Establishment of a novel small cell lung carcinoma cell line with specific recoverin expression from a patient with cancer-associated retinopathy.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...