Property Summary

NCBI Gene PubMed Count 96
Grant Count 196
R01 Count 138
Funding $12,745,930.6
PubMed Score 216.92
PubTator Score 622.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35241 A7YIJ8 A7YIK0 A7YIK3 B7Z9U6 F5H1A7 Q86Y61
Symbols DFNB24

Gene

RDX

Gene RIF (59)

PMID Text
26555866 Phospho-Ezrin/Radixin/Moesin (ERM) inhibit cell adhesion, and therefore, dephosphorylation of ERM proteins is essential for cell adhesion.Phospho-ERM induce formation and/or maintenance of spherical cell shape.
26500117 These studies identify Akt2 as a critical kinase that regulates radixin phosphorylation and leads to Mrp-2 translocation and function.
26209696 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
25520109 High Radixin expression is associated with glioblastoma.
25286001 Ezrin, radixin and moesin are unlikely targets for autoantibodies in demyelinating neuropathies.
24933454 Radixin was identified as a target gene of miR-196a/-196b. Elevated miR-196a/-196b expression in GC cells led to reduced radixin protein levels and vice versa.
24854655 These data suggest an association between RDX polymorphisms and the clinical features of RA patients, particularly the ESR
24788249 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKCepsilon-dependent manner.
24760896 HIV-1 Gag co-localizes with ezrin-radixin-moesin proteins at polarized HIV-1 assembly sites in human T cells
More...

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV      1 - 70
KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE     71 - 140
IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN    141 - 210
KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMER    281 - 350
LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE    351 - 420
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD    421 - 490
ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD    491 - 560
KYKTLRQIRQGNTKQRIDEFEAM                                                   561 - 583
//

Text Mined References (99)

PMID Year Title
26555866 2015 Inhibition of cell adhesion by phosphorylated Ezrin/Radixin/Moesin.
26500117 2016 Akt2-Dependent Phosphorylation of Radixin in Regulation of Mrp-2 Trafficking in WIF-B Cells.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
25520109 2014 Radixin knockdown by RNA interference suppresses human glioblastoma cell growth in vitro and in vivo.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25286001 2014 Are ERM (ezrin/radixin/moesin) proteins targets for autoantibodies in demyelinating neuropathies?
24933454 2014 MicroRNA-196a/-196b promote cell metastasis via negative regulation of radixin in human gastric cancer.
24854655 2014 Association study of polymorphisms between the Radixin gene and rheumatoid arthritis in a Korean population.
24788249 2014 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKC?-dependent manner.
More...