Property Summary

NCBI Gene PubMed Count 98
PubMed Score 221.35
PubTator Score 622.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
DEAFNESS, AUTOSOMAL RECESSIVE, 24 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0
Disease Target Count
Deafness, autosomal recessive 24 1

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -1.922 2.2e-02
adult high grade glioma 1.300 8.5e-04
astrocytic glioma 1.700 1.2e-02
Astrocytoma, Pilocytic 1.100 6.6e-06
atypical teratoid / rhabdoid tumor 1.400 3.4e-03
colon cancer -2.200 4.0e-02
dermatomyositis -1.400 2.6e-03
Down syndrome 1.900 5.4e-04
ependymoma 1.700 2.2e-02
Gaucher disease type 1 -1.600 3.4e-02
glioblastoma 1.400 6.1e-08
group 3 medulloblastoma -1.500 1.7e-02
hereditary spastic paraplegia -1.541 1.2e-03
intraductal papillary-mucinous adenoma (... -2.200 2.0e-02
intraductal papillary-mucinous carcinoma... -4.300 6.5e-04
intraductal papillary-mucinous neoplasm ... -3.100 9.8e-03
lung adenocarcinoma -1.100 5.0e-07
medulloblastoma, large-cell 2.600 2.0e-07
Multiple myeloma 1.444 3.7e-04
osteosarcoma 3.519 2.9e-06
ovarian cancer -2.600 5.0e-08
pancreatic ductal adenocarcinoma liver m... -1.544 4.5e-02
primitive neuroectodermal tumor 1.100 4.5e-04
progressive supranuclear palsy -1.200 7.2e-03
psoriasis -1.600 1.7e-03

Gene RIF (61)

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV      1 - 70
KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE     71 - 140
IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN    141 - 210
KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMER    281 - 350
LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE    351 - 420
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD    421 - 490
ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD    491 - 560
KYKTLRQIRQGNTKQRIDEFEAM                                                   561 - 583
//

Text Mined References (101)

PMID Year Title