Property Summary

NCBI Gene PubMed Count 28
PubMed Score 469.63
PubTator Score 48.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.300 9.8e-03
Astrocytoma, Pilocytic 1.500 8.5e-09
ependymoma 1.100 5.8e-10
glioblastoma 1.600 9.5e-04
medulloblastoma, large-cell -1.900 2.4e-03
nasopharyngeal carcinoma -1.400 4.4e-04
non-small cell lung cancer -1.102 1.2e-15
ovarian cancer -2.000 3.2e-05
pancreatic ductal adenocarcinoma liver m... 1.299 2.8e-02
subependymal giant cell astrocytoma 1.066 1.9e-02

Gene RIF (6)

AA Sequence

MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ      1 - 70
GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE     71 - 140
KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY    141 - 210
IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY    211 - 280
DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC    281 - 350
ADHPFLFFIQHSKTNGILFCGRFSSP                                                351 - 376
//

Text Mined References (36)

PMID Year Title