Property Summary

NCBI Gene PubMed Count 27
Grant Count 83
R01 Count 30
Funding $12,607,515.51
PubMed Score 835.74
PubTator Score 48.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35237 B2RBA8 Q59F97 Q5TD06 Q7Z2Y7 Q96J44 Q9UDI7
Symbols CAP
PI6
PTI
PI-6
SPI3
DFNB91
MSTP057

Gene

Gene RIF (6)

PMID Text
20451170 A truncating mutation in SERPINB6 is associated with autosomal-recessive nonsyndromic sensorineural hearing loss.
19425502 the discovery overexpression of GPD1 and RRBP1 proteins and lack of expression for HNRNPH1 and SERPINB6 proteins which are new candidate biomarkers of colon cancer.
18976975 Knockdown of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17761692 Protects the intracellular compartment of keratinocytes from ectopic kallikrein-8.
16175637 Expressed in developing gonads and in both somatic and germ cells of adult gonads.
14670919 In mast cells, SERPINB6 serves to regulate the activity of endogenous beta-tryptase in the cytoplasm.

AA Sequence

MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ      1 - 70
GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE     71 - 140
KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY    141 - 210
IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY    211 - 280
DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC    281 - 350
ADHPFLFFIQHSKTNGILFCGRFSSP                                                351 - 376
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20451170 2010 A truncating mutation in SERPINB6 is associated with autosomal-recessive nonsyndromic sensorineural hearing loss.
19425502 [Colorectal cancer 2D-proteomics: identification of altered protein expression].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...