Property Summary

NCBI Gene PubMed Count 29
Grant Count 18
R01 Count 16
Funding $1,279,550.42
PubMed Score 33.91
PubTator Score 21.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 0.005
osteosarcoma -3.421 0.000
glioblastoma 1.100 0.000
interstitial cystitis 1.800 0.003

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
521 confirmatory 728 / 6 / 113657 HTS Discovery of Chemical Inhibitors of HePTP, a Leukemia Target
1059 confirmatory 57 / 0 / 55 In Vitro HePTP Dose Response Colorimetric Assay for SAR Study
1077 confirmatory 149 / 0 / 96 Fluorescent secondary assay for dose-response confirmation of chemical inhibitors of HePTP
2068 confirmatory 110 / 0 / 18 MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds
2082 confirmatory 5 / 0 / 0 SAR Fluorescence HePTP Assay for Selectivity Study of VHR1 Inhibitors using DiFMUP
2085 summary 2 / 0 / 0 Summary assay for inhibitors of HePTP
2134 confirmatory 11 / 0 / 5 HTS HePTP Fluorescent Assay using OMFP substrate for In Vitro dose response studies
2678 confirmatory 31 / 0 / 24 SAR analysis of chemical inhibitors of HePTP using a Fluorescent assay - Set 2
435032 confirmatory 32 / 0 / 108 Dose Response confirmation of HTS hits from an HePTP Fluorescent Assay using OMFP substrate - Set 2
449736 confirmatory 67 / 0 / 28 SAR analysis of compounds that inhibit HePTP - Set 2
More...

Gene RIF (4)

PMID Text
20668459 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19053285 Interactions at the active site between KIM (kinase interaction motif)-phosphatases and their substrates are predominantly nonspecific, with the majority of the KIM-phosphatase residues coordinating the peptide backbone rather than residue side chains.
16441242 determined high-resolution structures of all of the human family members of Mitogen-Activated Protein Kinase-specific protein tyrosine phosphatases
16226275 structure of the protein tyrosine phosphatase catalytic domain of HePTP, residues 44-339

AA Sequence

MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREV      1 - 70
TLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGR     71 - 140
AQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPT    141 - 210
EEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPET    211 - 280
AAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALY    281 - 350
AGQLPEEPSP                                                                351 - 360
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20668459 2010 Genetic variants that affect length/height in infancy/early childhood in Vietnamese-Korean families.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19053285 2008 Structural basis of substrate recognition by hematopoietic tyrosine phosphatase.
18088087 2008 Phosphoproteome of resting human platelets.
16765894 2006 Docking interactions induce exposure of activation loop in the MAP kinase ERK2.
More...