Property Summary

Ligand Count 3
NCBI Gene PubMed Count 29
PubMed Score 35.94
PubTator Score 21.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.6e-07
glioblastoma 5792 4.4e-04
interstitial cystitis 2312 2.5e-03
cutaneous lupus erythematosus 1057 4.9e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 4.9e-03
glioblastoma 1.100 4.4e-04
interstitial cystitis 1.800 2.5e-03
osteosarcoma -3.421 1.6e-07

 GO Process (1)

Gene RIF (4)

AA Sequence

MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREV      1 - 70
TLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGR     71 - 140
AQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPT    141 - 210
EEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPET    211 - 280
AAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALY    281 - 350
AGQLPEEPSP                                                                351 - 360
//

Text Mined References (36)

PMID Year Title