Property Summary

NCBI Gene PubMed Count 666
Grant Count 577
R01 Count 361
Funding $61,849,318.45
PubMed Score 2206.34
PubTator Score 5437.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (85)

Disease Z-score Confidence
Vascular disease 281 4.866 2.4
Colitis 46 3.795 1.9
Arthritis 248 3.768 1.9
Leishmaniasis 49 3.663 1.8
Asthma 349 3.473 1.7
diabetes mellitus 1,663 3.404 1.7
Gastritis 44 3.399 1.7
Cancer 2,346 3.374 1.7
tuberculosis 1,557 3.345 1.7
Myocarditis 17 3.292 1.6
Multiple Sclerosis 498 3.225 1.6
Kidney disease 396 3.194 1.6
Lung disease 132 3.102 1.6
Acute kidney injury 65
Arthritis, Psoriatic 15
Asbestosis 10
Aspiration pneumonia 5
Atherosclerosis 275
Autistic Disorder 320
Brain Ischemia 87
Brain edema 26
Bronchial Diseases 3
Cardiovascular Abnormalities 7
Cerebrovascular accident 44
Cholangiocarcinoma 32
Cholangitis, Sclerosing 5
Cholestasis 93
Chronic Obstructive Airway Disease 47
Colonic Neoplasms 126
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Duodenal ulcer 20
Endotoxemia 8
Esophageal Neoplasms 67
Essential Hypertension 82
Focal glomerulosclerosis 22
Gastric ulcer 34
Heart failure 80
Hyperalgesia 71
Hyperemia 13
Hypertensive disease 193
Hypothermia, natural 12
Hypoxia-Ischemia, Brain 5
Inflammation 109
Inflammatory dermatosis 38
Intestinal Diseases 5
Kidney Diseases 86
Liver Cirrhosis, Experimental 108
Liver diseases 66
Lung Neoplasms 171
Malaria 140
Mammary Neoplasms 410
Manganese Poisoning 11
Marfan Syndrome 14
Mitochondrial Diseases 9
Mycoplasma Infections 3
Myocardial Infarction 126
Myocardial Reperfusion Injury 34
Myocardial stunning 8
Necrosis 51
Necrotizing Enterocolitis 17
Neoplastic Cell Transformation 81
PLASMODIUM FALCIPARUM BLOOD INFECTION LE... 4 
Pathological accumulation of air in tiss... 11 
Reperfusion Injury 84
Retinal Diseases 21
Schistosomiasis mansoni 3
Seizures 95
Sepsis 21
Septic Shock 5
Silicosis 10
Status Epilepticus 85
Stevens-Johnson syndrome 78
Subarachnoid Hemorrhage 5
Substance Withdrawal Syndrome 52
Takayasu Arteritis 4
Turner syndrome 31
Urinary tract infection 2
active Crohn's disease 918
chronic rhinosinusitis 512
cystic fibrosis and chronic rhinosinusit... 213 
lung carcinoma 2,844
psoriasis 6,685 2.0
severe asthma 11
ulcerative colitis 2,087

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 5.400 0.000
active Crohn's disease 1.168 0.029
lung carcinoma 1.200 0.000
ulcerative colitis 2.900 0.000
chronic rhinosinusitis -1.492 0.042
cystic fibrosis and chronic rhinosinusit... -1.824 0.026
severe asthma 1.100 0.013

Synonym

Accession P35228 A1L3U5 B7ZLY2 O60757 O94994 Q16263 Q16692 Q4TTS5 Q9UD42
Symbols NOS
INOS
NOS2A
HEP-NOS

Gene

PDB

2LL6   3HR4   1NSI   2NSI   3E7G   3EJ8   4CX7   4NOS  

 OMIM Term (1)

Gene RIF (684)

PMID Text
26854724 hsa-miR-26a-5p is a direct regulator of iNOS expression in human chondrocytes
26831417 i-NOS immunoexpression was not useful in differentiating reactional from non-reactional leprosy
26821117 In human ovarian cancer cells the inducible nitric oxide synthase (iNOS) is overexpressed leading to increased formation of nitric oxide (NO). The NO promotes a glycolytic phenotype (Warburg effect) leading to H+ generation, which are removed via the sodium, proton (H+) exchanger isoform 1 (NHE1) reducing the intracellular content of this acid equivalent.
26805735 The pathological tissues of Xuanwei lung-cancer patients express high level of NF-kappaB-p65, and iNOS.
26797421 MED27 promotes melanoma growth by targeting AKT/MAPK and NF-kappaB/iNOS signaling pathways.
26756734 These data suggest that tumour-derived iNOS is an important mediator of tumour growth and vessel maturation, hence a promising target for anti-vascular cancer therapies
26751080 coactivator p300 mediates cytokine-induced hiNOS transactivation by forming a distant DNA loop between its enhancer and core promoter region
26647762 These results showed that alterations in the expression levels of Arg I and iNOS in the peripheral T cells and peripheral nodes of HIV infected patients are associated with disease progression in these patients.
26590086 data indicate that up-regulation of twist is correlated with the ER presenting breast cancer, and iNOS expression was positively correlated with tumour-node metastasis (TNM) staging of breast cancer
26586908 INOS and eNOS are the main contributors to NOS-dependent sweating.
More...

AA Sequence

MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPES      1 - 70
LVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELL     71 - 140
PQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQ    141 - 210
VFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGD    211 - 280
PANVEFTQLCIDLGWKPKYGRFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALP    281 - 350
AVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI    351 - 420
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYY    421 - 490
YQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGAL    491 - 560
FSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKELNNKFRYAVFGLGSSM    561 - 630
YPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTS    631 - 700
NVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPG    701 - 770
EHLGVCPGNQPALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ    771 - 840
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLPILKPRFYSI    841 - 910
SSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCFVRNASGFHLPEDPSHPCILI    911 - 980
GPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPG    981 - 1050
KPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQ   1051 - 1120
KRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL                                        1121 - 1153
//

Text Mined References (672)

PMID Year Title
26854724 2016 MicroRNA-26a-5p regulates the expression of inducible nitric oxide synthase via activation of NF-?B pathway in human osteoarthritis chondrocytes.
26831417 2015 Is CXCL10/CXCR3 axis overexpression a better indicator of leprosy type 1 reaction than inducible nitric oxide synthase?
26821117 2016 Are NHE1 and inducible nitric oxide synthase involved in human ovarian cancer?
26805735 2016 [Association of Inorganics Accumulation with the Activation of NF-?B Signaling Pathway and the iNOS Expression of Lung Tissue in Xuanwei Lung Cancer Patients].
26797421 2016 MED27 promotes melanoma growth by targeting AKT/MAPK and NF-?B/iNOS signaling pathways.
26756734 2016 Investigating the role of tumour cell derived iNOS on tumour growth and vasculature in vivo using a tetracycline regulated expression system.
26751080 2016 Up-Regulation of Human Inducible Nitric Oxide Synthase by p300 Transcriptional Complex.
26647762 2016 Expression of arginase I and inducible nitric oxide synthase in the peripheral blood and lymph nodes of HIV?positive patients.
26590086 2016 Significance of twist and iNOS expression in human breast carcinoma.
26586908 2016 iNOS-dependent sweating and eNOS-dependent cutaneous vasodilation are evident in younger adults, but are diminished in older adults exercising in the heat.
More...