Property Summary

Ligand Count 405
NCBI Gene PubMed Count 707
PubMed Score 2277.53
PubTator Score 5437.90

Knowledge Summary


No data available


  Disease (6)

Disease Target Count Z-score Confidence
Colitis 54 3.812 1.9
Asthma 385 3.607 1.8
Acute kidney injury 70 0.0 0.0
Arthritis, Psoriatic 14 0.0 0.0
Asbestosis 20 0.0 0.0
Atherosclerosis 291 0.0 0.0
Autistic Disorder 364 0.0 0.0
Brain Edema 50 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Bronchial Diseases 3 0.0 0.0
Burns 9 0.0 0.0
Cardiovascular Abnormalities 31 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Cholangiocarcinoma 35 0.0 0.0
Cholangitis, Sclerosing 6 0.0 0.0
Cholestasis 155 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Duodenal ulcer 20 0.0 0.0
Emphysema 12 0.0 0.0
Endotoxemia 8 0.0 0.0
Enterocolitis, Necrotizing 17 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Essential Hypertension 94 0.0 0.0
Glomerulosclerosis, Focal Segmental 28 0.0 0.0
Heart failure 162 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hyperemia 13 0.0 0.0
Hypertension 396 0.0 0.0
Hypothermia 12 0.0 0.0
Hypoxia-Ischemia, Brain 5 0.0 0.0
Inflammation 120 0.0 0.0
Intestinal Diseases 11 0.0 0.0
Kidney Diseases 114 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver diseases 87 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Malaria 160 0.0 0.0
Manganese Poisoning 11 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Mitochondrial Diseases 9 0.0 0.0
Mycoplasma Infections 3 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Myocardial stunning 8 0.0 0.0
Necrosis 53 0.0 0.0
Parkinson Disease, Secondary 9 0.0 0.0
Pneumonia, Aspiration 1 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Diseases 55 0.0 0.0
Schistosomiasis mansoni 3 0.0 0.0
Seizures 596 0.0 0.0
Sepsis 24 0.0 0.0
Shock, Septic 6 0.0 0.0
Silicosis 12 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Stroke 33 0.0 0.0
Subarachnoid Hemorrhage 7 0.0 0.0
Substance Withdrawal Syndrome 55 0.0 0.0
Takayasu Arteritis 4 0.0 0.0
Turner syndrome 28 0.0 0.0
Ureteral obstruction 33 0.0 0.0
Urinary Tract Infections 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 2.55669640541971E-171


  Differential Expression (7)

Disease log2 FC p
psoriasis 5.400 2.6e-171
active Crohn's disease 1.168 2.9e-02
chronic rhinosinusitis -1.492 4.2e-02
cystic fibrosis and chronic rhinosinusit... -1.824 2.6e-02
lung carcinoma 1.200 9.3e-05
mild-moderate asthma 1.100 1.6e-02
ulcerative colitis 2.900 4.8e-08

 OMIM Phenotype (1)

Gene RIF (726)

AA Sequence

KRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL                                        1121 - 1153

Text Mined References (713)

PMID Year Title