Property Summary

NCBI Gene PubMed Count 40
PubMed Score 40.73
PubTator Score 40.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 1.09975298812227E-13
posterior fossa group A ependymoma 1511 1.17415748480921E-8
atypical teratoid / rhabdoid tumor 4369 1.07034821455645E-7
pilocytic astrocytoma 3086 1.71418757196895E-6
group 4 medulloblastoma 1875 2.00189816220993E-6
malignant mesothelioma 3163 2.11956274598524E-6
psoriasis 6685 1.26650981676381E-5
osteosarcoma 7933 1.55693560633255E-4
primary Sjogren syndrome 789 7.41383186057981E-4
primitive neuroectodermal tumor 3031 0.00118324738967137
ovarian cancer 8492 0.00702948216011766
oligodendroglioma 2849 0.0275414877810761

Synonym

Accession P35227 A6NGD8
Symbols MEL-18
RNF110
ZNF144

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (26)

PMID Text
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
25822021 Mel-18 underexpression in luminal breast cancer cells caused ER-alpha downregulation.Its overexpression restored it in triple-negative breast cancer cells. MEL-18 suppressed SUMOylation of the ESR1 transactivators p53 and SP1.
24964959 It was therefore concluded that the lower Mel-18 expression might contribute to colorectal cancer development/progression.
23474752 Mel-18 functions as a tumor suppressor by its novel negative control of the epithelial-mesenchymal transition in breast cancer.
22954590 Findings suggest that Mel-18 is a novel negative regulator of breast cancer stem cell (CSC) that inhibits the stem cell population and in vitro and in vivo self-renewal through the inactivation of Wnt-mediated Notch signaling.
22085718 PCGF2, a PRC1 gene, played a negative role in the granulocytic differentiation of human APL cells.
21602890 these findings provide that Mel-18 is a novel regulator of tumor angiogenesis through regulating HIF-1alpha and its target VEGF expressions mediated by the PTEN/PI3K/Akt pathway, suggesting a new tumor-suppressive role of Mel-18 in human breast cancer.
21162745 Bmi-1/Mel-18 ratio can be potentially used as a tool for stratifying women at risk of developing breast malignancy.
21059209 Decreased Mel-18 and increased Bmi-1 mRNA expression was associated with the carcinogenesis and progression of gastric cancer
20801102 Mel-18 plays a significant role in the angiogenic function of endothelial cells by regulating endothelial gene expression.
More...

AA Sequence

MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR      1 - 70
SDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEG     71 - 140
ARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMD    141 - 210
IAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPA    211 - 280
TPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT          281 - 344
//

Text Mined References (43)

PMID Year Title
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
25822021 2015 MEL-18 loss mediates estrogen receptor-? downregulation and hormone independence.
25416956 2014 A proteome-scale map of the human interactome network.
24964959 2014 Expression and clinicopathological significance of Mel-18 mRNA in colorectal cancer.
23474752 2014 Loss of the polycomb protein Mel-18 enhances the epithelial-mesenchymal transition by ZEB1 and ZEB2 expression through the downregulation of miR-205 in breast cancer.
22954590 2012 Loss of Mel-18 enhances breast cancer stem cell activity and tumorigenicity through activating Notch signaling mediated by the Wnt/TCF pathway.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22085718 2011 Inhibition of PCGF2 enhances granulocytic differentiation of acute promyelocytic leukemia cell line HL-60 via induction of HOXA7.
21602890 2011 Loss of Mel-18 induces tumor angiogenesis through enhancing the activity and expression of HIF-1? mediated by the PTEN/PI3K/Akt pathway.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
More...