Property Summary

NCBI Gene PubMed Count 40
Grant Count 7
R01 Count 4
Funding $305,582.66
PubMed Score 40.73
PubTator Score 40.72

Knowledge Summary

Patent

No data available

Gene RIF (26)

PMID Text
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
25822021 Mel-18 underexpression in luminal breast cancer cells caused ER-alpha downregulation.Its overexpression restored it in triple-negative breast cancer cells. MEL-18 suppressed SUMOylation of the ESR1 transactivators p53 and SP1.
24964959 It was therefore concluded that the lower Mel-18 expression might contribute to colorectal cancer development/progression.
23474752 Mel-18 functions as a tumor suppressor by its novel negative control of the epithelial-mesenchymal transition in breast cancer.
22954590 Findings suggest that Mel-18 is a novel negative regulator of breast cancer stem cell (CSC) that inhibits the stem cell population and in vitro and in vivo self-renewal through the inactivation of Wnt-mediated Notch signaling.
22085718 PCGF2, a PRC1 gene, played a negative role in the granulocytic differentiation of human APL cells.
21602890 these findings provide that Mel-18 is a novel regulator of tumor angiogenesis through regulating HIF-1alpha and its target VEGF expressions mediated by the PTEN/PI3K/Akt pathway, suggesting a new tumor-suppressive role of Mel-18 in human breast cancer.
21162745 Bmi-1/Mel-18 ratio can be potentially used as a tool for stratifying women at risk of developing breast malignancy.
21059209 Decreased Mel-18 and increased Bmi-1 mRNA expression was associated with the carcinogenesis and progression of gastric cancer
20801102 Mel-18 plays a significant role in the angiogenic function of endothelial cells by regulating endothelial gene expression.
More...

AA Sequence

MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR      1 - 70
SDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEG     71 - 140
ARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMD    141 - 210
IAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPA    211 - 280
TPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT          281 - 344
//

Text Mined References (43)

PMID Year Title
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
25822021 2015 MEL-18 loss mediates estrogen receptor-? downregulation and hormone independence.
25416956 2014 A proteome-scale map of the human interactome network.
24964959 2014 Expression and clinicopathological significance of Mel-18 mRNA in colorectal cancer.
23474752 2014 Loss of the polycomb protein Mel-18 enhances the epithelial-mesenchymal transition by ZEB1 and ZEB2 expression through the downregulation of miR-205 in breast cancer.
22954590 2012 Loss of Mel-18 enhances breast cancer stem cell activity and tumorigenicity through activating Notch signaling mediated by the Wnt/TCF pathway.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22085718 2011 Inhibition of PCGF2 enhances granulocytic differentiation of acute promyelocytic leukemia cell line HL-60 via induction of HOXA7.
21602890 2011 Loss of Mel-18 induces tumor angiogenesis through enhancing the activity and expression of HIF-1? mediated by the PTEN/PI3K/Akt pathway.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
More...