Property Summary

NCBI Gene PubMed Count 44
PubMed Score 43.84
PubTator Score 40.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.100 1.1e-13
Astrocytoma, Pilocytic 1.400 1.7e-06
atypical teratoid / rhabdoid tumor 1.400 1.1e-07
ependymoma 1.300 3.7e-02
group 3 medulloblastoma 1.100 3.2e-03
malignant mesothelioma 1.500 2.1e-06
oligodendroglioma 1.400 2.8e-02
osteosarcoma -1.222 1.6e-04
ovarian cancer -1.200 7.0e-03
primary Sjogren syndrome -1.100 7.4e-04
primitive neuroectodermal tumor 1.300 8.9e-04
psoriasis -2.400 1.3e-05

Gene RIF (26)

AA Sequence

MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR      1 - 70
SDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEG     71 - 140
ARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMD    141 - 210
IAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPA    211 - 280
TPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT          281 - 344
//

Text Mined References (48)

PMID Year Title