Property Summary

NCBI Gene PubMed Count 415
PubMed Score 758.09
PubTator Score 657.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.100 3.9e-03
dermatomyositis 1.200 2.0e-03
group 3 medulloblastoma 1.200 1.0e-02
ovarian cancer -1.500 3.3e-05

Protein-protein Interaction (2)

Gene RIF (371)

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR      1 - 70
SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ     71 - 140
NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA    141 - 210
YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ    211 - 280
SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG                            281 - 326
//

Text Mined References (420)

PMID Year Title