Property Summary

NCBI Gene PubMed Count 358
Grant Count 294
R01 Count 169
Funding $34,179,353.8
PubMed Score 691.33
PubTator Score 657.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.500 0.000
breast carcinoma 1.100 0.004
ovarian cancer -1.500 0.000
dermatomyositis 1.200 0.002

Synonym

Accession P35226 Q16030 Q5T8Z3 Q96F37
Symbols PCGF4
RNF51
FLVI2/BMI1
flvi-2/bmi-1

Gene

PANTHER Protein Class (2)

PDB

3RPG   4R8P   2H0D  

Gene RIF (319)

PMID Text
26935956 Data indicate that overexpression of polycomb complex protein BMI-1 (BMI-1) in multiple myeloma (MM) highlighting its role as an attractive drug target.
26763885 These data show that BMI1 regulates cell proliferation, apoptosis, and differentiation of human mesenchymal stem cells.
26690524 Overexpression of CD133 mRNA and BMI1 protein was found in 47.6 and 76.2% patients respectively.
26679841 up-regulation or down-regulation of BMI1 induced resistance or sensitivity to BRAF inhibitor treatment and that induction of noncanonical Wnt by BMI1 is required for this resistance
26633535 BMI1 ubiquitinates histone H2A and gammaH2AX, thereby facilitating the repair of double-stranded DNA breaks through stimulating homologous recombination and non-homologous end joining. [review]
26623561 Data show that PTC-209 caused an up-regulation of BMI1 on mRNA level, BMI1 protein levels were clearly reduced after PTC-209 treatment.
26578590 The polycomb complex proteins BMI1 and RING1A regulate the ubiquitination of chromatin associated proteins bound to promoters.
26573774 These results provide important insights into the role of Bmi-1 in the occurrence and development of nasopharyngeal carcinoma
26573508 MKK3 overexpression upregulated the cyclin-dependent kinase inhibitors, p16 INK4A and p15 INK4B in hepatocellular carcinoma cells was Bim1, was downregulated following MKK3 overexpression.
26517683 Data show that increased polycomb repressive complex 2 EZH2 and/or polycomb repressive complex 1 BMI1 expression repress the expression of microRNA miR-200 family members.
More...

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR      1 - 70
SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ     71 - 140
NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA    141 - 210
YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ    211 - 280
SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG                            281 - 326
//

Text Mined References (361)

PMID Year Title
26935956 2016 Targeting of BMI-1 with PTC-209 shows potent anti-myeloma activity and impairs the tumour microenvironment.
26763885 2016 BMI1 Regulation of Self-Renewal and Multipotency in Human Mesenchymal Stem Cells.
26690524 2015 CD133 and BMI1 expressions and its prognostic role in primary glioblastoma.
26679841 2016 BMI1 induces an invasive signature in melanoma that promotes metastasis and chemoresistance.
26633535 2015 A Novel Aspect of Tumorigenesis-BMI1 Functions in Regulating DNA Damage Response.
26623561 2016 The BMI1 inhibitor PTC-209 is a potential compound to halt cellular growth in biliary tract cancer cells.
26578590 2016 RING1A and BMI1 bookmark active genes via ubiquitination of chromatin-associated proteins.
26573774 2016 Downregulation of Bmi-1 is associated with suppressed tumorigenesis and induced apoptosis in CD44? nasopharyngeal carcinoma cancer stem-like cells.
26573508 2016 Mitogen-activated protein kinase kinase 3 induces cell cycle arrest via p38 activation mediated Bmi-1 downregulation in hepatocellular carcinoma.
26517683 2015 A Polycomb-mir200 loop regulates clinical outcome in bladder cancer.
More...