Property Summary

NCBI Gene PubMed Count 537
PubMed Score 1774.22
PubTator Score 1872.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35225 O43644 Q4VB52 Q9UDC7 IL-13
Symbols P600
IL-13

Gene

PDB

3BPO   5E4E   1GA3   1IJZ   1IK0   1J9U   3G6D   3ITR   3ITS   3L5W   3L5X   3LB6   4I77   4PS4  

  Ortholog (5)

Gene RIF (561)

PMID Text
26986948 Data show that single nucleotide polymorphisms (SNPs) rs848 in the interleukin 13 (IL13) gene region is significantly associated with a continuous measure of symptom severity in adult subjects with ever asthma.
26897823 IL-13 may induce mitral valvular fibrosis rheumatic heart disease.
26831416 investigated five SNPs (C-589T and C-33T of IL4, G+2044A of IL13, A+1902G of IL4Ralpha, and A+896G of TLR4) in patients with adult onset asthma to evaluate their role in manifestation and severity of asthma
26693492 genetic polymorphism is associated with autoimmune hepatitis in Brazilian children
26516307 a protective role of mutant alleles G and A in IL-10-1082A/G and IL-13+2044G/A against gliomas.
26474238 IL-13 is a type 2 cytokine that is a key mediator of airway inflammation and remodeling in many inflammatory diseases of the lung, such as asthma. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201506-1243OC#.V2bnHdLrtNs
26436920 IL-13 induces miR-142-5p and downregulates miR-130a-3p in macrophages, regulating macrophage profibrogenic gene expression in chronic inflammation.
26418997 rs2158177 polymorphism of the IL-13 gene is associated with asthma in ethnic Han Chinese from Qingdao. No association has been found between polymorphisms of TNF-alpha gene with susceptibility to asthma.
26407210 Our in vitro and in vivo data indicate close cooperation between mechanical and inflammatory stimuli on TF expression and release of TF-positive extracellular vesicles in the lungs, which may contribute to pathophysiology of asthma
26399722 DNA hypomethylation of IL13 gene may be associated with increased risk of allergic rhinitis from house dust mite sensitization
More...

AA Sequence

MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSI      1 - 70
NLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLF     71 - 140
REGRFN                                                                    141 - 146
//

Text Mined References (541)

PMID Year Title
26986948 2016 An Interleukin 13 Polymorphism Is Associated with Symptom Severity in Adult Subjects with Ever Asthma.
26897823 2015 The Role of Interleukin-13 in Patients with Rheumatic Valvular Fibrosis: A Clinical and Histological Study.
26831416 2015 A preliminary study on the association of single nucleotide polymorphisms of interleukin 4 (IL4), IL13, IL4 receptor alpha (IL4R?) & Toll-like receptor 4 (TLR4) genes with asthma in Indian adults.
26693492 2015 Autoimmune Hepatitis in Brazilian Children: IgE and Genetic Polymorphisms in Associated Genes.
26516307 2015 Single Nucleotide Polymorphisms in IL-10, IL-12p40, and IL-13 Genes and Susceptibility to Glioma.
26474238 2016 Genome-Wide Methylation Study Identifies an IL-13-induced Epigenetic Signature in Asthmatic Airways.
26436920 2015 miR-142-5p and miR-130a-3p are regulated by IL-4 and IL-13 and control profibrogenic macrophage program.
26418997 2015 [Association of TNF-alpha and IL-13 genes polymorphisms with bronchial asthma].
26407210 2016 IL-13 Augments Compressive Stress-Induced Tissue Factor Expression in Human Airway Epithelial Cells.
26399722 2016 Association between DNA hypomethylation at IL13 gene and allergic rhinitis in house dust mite-sensitized subjects.
More...