Property Summary

NCBI Gene PubMed Count 579
PubMed Score 1913.92
PubTator Score 1872.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Psoriatic arthritis 86 0.0 5.0

Expression

Protein-protein Interaction (1)

Gene RIF (602)

AA Sequence

MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSI      1 - 70
NLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLF     71 - 140
REGRFN                                                                    141 - 146
//

Text Mined References (582)

PMID Year Title