Property Summary

NCBI Gene PubMed Count 1,757
PubMed Score 8818.30
PubTator Score 5488.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
non-small cell lung cancer 2798 1.04919563995615E-18
osteosarcoma 7933 3.85388482671768E-6
tuberculosis 1563 1.37198264420146E-4
glioblastoma 5572 3.14724211820095E-4
atypical teratoid / rhabdoid tumor 4369 3.41984255804771E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 5.42460917551972E-4
psoriasis 6685 6.62709300654887E-4
medulloblastoma, large-cell 6234 0.00128002284887883
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00253628474839251
primary pancreatic ductal adenocarcinoma 1271 0.00381646002620879
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00444919960606308
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00868436243300378
gastric carcinoma 832 0.0120615770631838
sonic hedgehog group medulloblastoma 1482 0.0129144242463073
primitive neuroectodermal tumor 3031 0.0189901632735493
posterior fossa group B ependymoma 1530 0.0276468502642475
Disease Target Count Z-score Confidence
Osteoporosis 259 4.505 2.3
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count
Mesothelioma, malignant 4

Expression

See source...

Synonym

Accession P35222 A8K1L7 Q8NEW9 Q8NI94 Q9H391
Symbols CTNNB
MRD19
armadillo

Gene

PANTHER Protein Class (1)

PDB

1T08   1TH1   1P22   1G3J   1JDH   1JPW   1LUJ   1QZ7   2G57   2GL7   2Z6H   3DIW   3FQN   3FQR   3SL9   3SLA   3TX7   4DJS  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1665 confirmatory 587 / 52 / 193019 High Throughput Imaging Assay for Beta-Catenin
1685 summary 0 / 0 / 0 Summary Assay for Beta-Catenin

Gene RIF (1498)

PMID Text
27069136 Beta-Catenin plays a major oncogenic role in oral squamous cell carcinoma, principally through increase in invasiveness due to loss of its membranous expression
27067790 The results suggest a role for beta-catenin/LEF1-mediated transcription in both malignant transformation and metastasis of prostate cancer
27014877 the beta-catenin/Tcf4 interaction is disrupted by BC-23
27003775 level associated with T and N stage in esophagogastric junction adenocarcinoma
26997628 Decreased inhibition of beta-catenin was correlated with aberrant parenchyma in idiopathic pulmonary fibrosis patients.
26981862 data suggests that CYP1B1 promotes cell proliferation and metastasis by inducing EMT and Wnt/beta-catenin signaling via Sp1 induction
26959414 These findings suggest a novel relationship between miR-3162-3p and beta-catenin and clarify their mechanistic role in asthma etiopathogenesis.
26944016 Our findings identify the eIF4E- beta-catenin axis as a critical regulator of lung cancer cell growth and survival, and suggest that its pharmacological inhibition may be therapeutically useful in lung cancer.
26927026 This study detected CTNNB1 mutations in Adamantinomatous craniopharyngiomas.
26912724 Deubiquitinated FoxM1 accumulation in the nucleus promotes recruitment of beta-catenin to Wnt target-gene promoter and activates the Wnt signaling pathway by protecting the beta-catenin/TCF4 complex from ICAT inhibition.
More...

AA Sequence

MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF      1 - 70
SQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI     71 - 140
NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET    141 - 210
ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ    211 - 280
KMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC    281 - 350
SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA    351 - 420
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG    421 - 490
LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF    491 - 560
VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA    561 - 630
IEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI    631 - 700
GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD    701 - 770
SNQLAWFDTDL                                                               771 - 781
//

Text Mined References (1780)

PMID Year Title
27069136 2016 Implications of Differential Expression of ?-Catenin in Oral Carcinoma.
27067790 2016 Expression and colocalization of ?-catenin and lymphoid enhancing factor-1 in prostate cancer progression.
27014877 2016 Enhancement of Radiation Sensitivity in Lung Cancer Cells by a Novel Small Molecule Inhibitor That Targets the ?-Catenin/Tcf4 Interaction.
27003775 2015 Expression of ?-catenin and its correlation with metastatic progression of esophagogastric junction adenocarcinoma.
26997628 2016 Aberrant nonfibrotic parenchyma in idiopathic pulmonary fibrosis is correlated with decreased ?-catenin inhibition and increased Wnt5a/b interaction.
26981862 2016 CYP1B1 Enhances Cell Proliferation and Metastasis through Induction of EMT and Activation of Wnt/?-Catenin Signaling via Sp1 Upregulation.
26959414 2016 MiR-3162-3p Is a Novel MicroRNA That Exacerbates Asthma by Regulating ?-Catenin.
26944016 2016 Antibiotic drug rifabutin is effective against lung cancer cells by targeting the eIF4E-?-catenin axis.
26927026 2016 Adamantinomatous and papillary craniopharyngiomas are characterized by distinct epigenomic as well as mutational and transcriptomic profiles.
26912724 2016 Wnt-induced deubiquitination FoxM1 ensures nucleus ?-catenin transactivation.
More...